Comparing Pf1N1B4_5661 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5661 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
67% identity, 100% coverage: 5:1235/1236 of query aligns to 2:1225/1227 of P13009
Sites not aligning to the query:
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
55% identity, 99% coverage: 15:1236/1236 of query aligns to 26:1264/1265 of Q99707
3ivaA Structure of the b12-dependent methionine synthase (meth) c-teminal half with adohcy bound (see paper)
60% identity, 47% coverage: 654:1235/1236 of query aligns to 3:575/576 of 3ivaA
3bulA E. Coli i690c/g743c meth c-terminal fragment (649-1227) (see paper)
60% identity, 47% coverage: 654:1235/1236 of query aligns to 3:575/577 of 3bulA
4cczA Crystal structure of human 5-methyltetrahydrofolate-homocysteine methyltransferase, the homocysteine and folate binding domains
56% identity, 50% coverage: 15:638/1236 of query aligns to 10:610/611 of 4cczA
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
37% identity, 68% coverage: 13:856/1236 of query aligns to 7:822/841 of 8g3hA
3k13C Structure of the pterin-binding domain metr of 5- methyltetrahydrofolate-homocysteine methyltransferase from bacteroides thetaiotaomicron
64% identity, 23% coverage: 359:642/1236 of query aligns to 4:286/287 of 3k13C
6bdyA Crystal structure of the meth reactivation domain bound to sinefungin (see paper)
55% identity, 26% coverage: 919:1235/1236 of query aligns to 16:325/326 of 6bdyA
1mskA Methionine synthase (activation domain) (see paper)
55% identity, 26% coverage: 919:1235/1236 of query aligns to 16:325/327 of 1mskA
1bmtA How a protein binds b12: a 3.O angstrom x-ray structure of the b12- binding domains of methionine synthase (see paper)
72% identity, 19% coverage: 654:894/1236 of query aligns to 3:241/246 of 1bmtA
8sseA Methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8
30% identity, 44% coverage: 662:1202/1236 of query aligns to 4:506/507 of 8sseA
3bofA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ and homocysteine (see paper)
28% identity, 47% coverage: 15:601/1236 of query aligns to 11:538/560 of 3bofA
1q8jA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex) (see paper)
28% identity, 47% coverage: 15:601/1236 of query aligns to 11:538/559 of 1q8jA
5vooA Methionine synthase folate-binding domain with methyltetrahydrofolate from thermus thermophilus hb8 (see paper)
37% identity, 23% coverage: 357:637/1236 of query aligns to 1:275/282 of 5vooA
2i2xB Crystal structure of methanol:cobalamin methyltransferase complex mtabc from methanosarcina barkeri (see paper)
31% identity, 16% coverage: 648:841/1236 of query aligns to 27:216/258 of 2i2xB
Sites not aligning to the query:
Q46EH4 Methanol--corrinoid protein; Methanol:corrinoid methyltransferase 1 subunit of 27 kDa; MT1 subunit 27 kDa from Methanosarcina barkeri (strain Fusaro / DSM 804) (see paper)
31% identity, 16% coverage: 648:841/1236 of query aligns to 27:216/258 of Q46EH4
Sites not aligning to the query:
7xcnP Crystal structure of the mttb-mttc complex at 2.7 a resolution (see paper)
31% identity, 14% coverage: 690:863/1236 of query aligns to 36:213/215 of 7xcnP
3ezxA Structure of methanosarcina barkeri monomethylamine corrinoid protein
36% identity, 15% coverage: 657:840/1236 of query aligns to 2:185/212 of 3ezxA
Sites not aligning to the query:
4jgiB 1.5 angstrom crystal structure of a novel cobalamin-binding protein from desulfitobacterium hafniense dcb-2 (see paper)
34% identity, 11% coverage: 700:836/1236 of query aligns to 44:174/206 of 4jgiB
Sites not aligning to the query:
4djfA Crystal structure of folate-bound corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr), co-crystallized with folate and ti(iii) citrate reductant (see paper)
28% identity, 22% coverage: 362:627/1236 of query aligns to 4:249/262 of 4djfA
>Pf1N1B4_5661 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5661
MSDRSVRLQALKHALKERILILDGGMGTMIQSYKLEEQDYRGKRFADWPSDVKGNNDLLV
LTRPDVIGGIEKAYLDAGADILETNTFNATRISMADYGMEELAYELNVEGARLARKIADA
KTLENPDKPRFVAGVLGPTSRTCSLSPDVNNPGYRNVTFDELVENYTEATKGLIEGGADL
ILIETIFDTLNAKAAIFAVQGVFEELGVELPIMISGTITDASGRTLSGQTTEAFWNSVAH
AKPISVGLNCALGASELRPYLEELSNKANTHVSAHPNAGLPNEFGEYDELPAQTAKVIEE
FAQSGFLNIVGGCCGTTPGHIEAIAKAVAGYAPREIPDIPKACRLSGLEPFTIDRSSLFV
NVGERTNITGSAKFARLIREDNYTEALEVALQQVEAGAQVIDINMDEGMLDSKKAMVTFL
NLIAGEPDISRVPIMIDSSKWEVIEAGLKCIQGKGIVNSISMKEGVEQFIHHAKLCKRYG
AAVVVMAFDEAGQADTEARKKEICKRSYDILVNEVGFPPEDIIFDPNIFAVATGIEEHNN
YAVDFINACAYIRDELPYALTSGGVSNVSFSFRGNNPVREAIHSVFLLYAIRNGLTMGIV
NAGQLEIYDQIPAELRDAVEDVILNRTPEGTDALLAIADKYKGDGSVKEAETEEWRNWDV
NKRLEHALVKGITTHIVEDTEESRQSFARPIEVIEGPLMSGMNIVGDLFGAGKMFLPQVV
KSARVMKQAVAHLIPFIELEKGDKPEAKGKILMATVKGDVHDIGKNIVGVVLGCNGYDIV
DLGVMVPAEKILQVAKEQKCDIIGLSGLITPSLDEMVHVAREMQRQDFHLPLMIGGATTS
KAHTAVKIEPKYSNDAVIYVTDASRAVGVATQLLSKELKAGFVEKTRLEYIDVRERTANR
SARTERLSYPVAIAKKPQFDWGSYEPVKPTFTGAKVLDNIDLKVLAEYIDWTPFFISWDL
AGKFPRILKDEVVGEAATALYADAQEMLAKLIDEKLISARAVFGFWPANQVRDDDIEVYD
DDGKPLAKLHHLRQQIIKTDGKPNFSLADFVAPKDSGVTDYVGGFITTAGIGAEEVAKAY
QDAGDDYNSIMVKALADRLAEACAEWLHQQVRKDYWGYAKDETLDNEALIKEQYTGIRPA
PGYPACPDHTEKATLFKLLDPEAEELKAGRSGVFLTEHYAMFPAAAVSGWYFAHPQAQYF
AVGKIDKDQVQSYTSRKGQELSVTERWLAPNLGYDN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory