Comparing Pf1N1B4_5706 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5706 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
34% identity, 52% coverage: 114:308/373 of query aligns to 81:272/303 of 8sutA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
34% identity, 52% coverage: 114:308/373 of query aligns to 80:271/303 of 8skyB
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
30% identity, 64% coverage: 115:352/373 of query aligns to 53:249/265 of 3r6oA
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
30% identity, 77% coverage: 84:371/373 of query aligns to 19:280/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
30% identity, 77% coverage: 84:371/373 of query aligns to 19:280/290 of 8gsrA
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
34% identity, 54% coverage: 115:314/373 of query aligns to 59:251/277 of 6iymA
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
29% identity, 59% coverage: 87:307/373 of query aligns to 29:246/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
29% identity, 59% coverage: 87:307/373 of query aligns to 29:246/280 of 6j5xA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
32% identity, 51% coverage: 119:309/373 of query aligns to 64:247/279 of 6v77B
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
30% identity, 62% coverage: 75:306/373 of query aligns to 2:223/252 of 3qdfA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
26% identity, 56% coverage: 104:311/373 of query aligns to 42:247/269 of 4dbhA
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
28% identity, 50% coverage: 120:306/373 of query aligns to 4:190/218 of 6fogA
Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
28% identity, 50% coverage: 120:306/373 of query aligns to 9:195/224 of Q6P587
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
27% identity, 50% coverage: 120:306/373 of query aligns to 3:189/216 of 6sbiA
Sites not aligning to the query:
1gttA Crystal structure of hpce (see paper)
28% identity, 53% coverage: 110:308/373 of query aligns to 192:392/421 of 1gttA
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
29% identity, 49% coverage: 125:306/373 of query aligns to 24:206/233 of 6j5yA
1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
25% identity, 50% coverage: 125:312/373 of query aligns to 9:214/247 of 1nkqA
6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
26% identity, 53% coverage: 114:311/373 of query aligns to 66:241/264 of 6jvwB
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
25% identity, 49% coverage: 126:306/373 of query aligns to 17:195/224 of 3v77A
5ti1H Crystal structure of fumarylacetoacetate hydrolase from burkholderia xenovorans lb400
26% identity, 47% coverage: 174:347/373 of query aligns to 206:401/430 of 5ti1H
Sites not aligning to the query:
>Pf1N1B4_5706 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5706
MSGNATRYGRRDVLKAGALIVGGSLVYSVASPPSEQHHSSRAAEHGTNAAPGVPSMSAVH
VVRFEFQNGIHWGVLRQGRITVVPGAFETTGDFIRENSIDDLAQLKGTELAEGEVKLLSP
VTRNQQFVCQGANYRQHMIESGMDPDAKKFNMIFTKATSCLVAADSDLIKPRTVRFLDYE
IELGLVMKRAINGAVAVTDANLHEFIAGVVIVNDYSARDIQIPQMQFYKGKSFRTFGPVG
PYLCLLDATNIHYLKELQLRLTVNDQVRQNDSTANLVYGPAETLTELSALQDFAAGDLIA
TGTPAGCALTVPSPAKQRIAALMPEATKWKLFLKAQEGRTQYLKPGDVVEARIRSADGVI
DLGVQRNRVVEQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory