SitesBLAST
Comparing Pf1N1B4_5800 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5800 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O85673 Anthranilate 1,2-dioxygenase large subunit; EC 1.14.12.1 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see 2 papers)
46% identity, 96% coverage: 7:440/454 of query aligns to 12:450/471 of O85673
- M43 (= M38) mutation to K: Prevents anthranilate degradation.
- D217 (= D214) mutation to A: In ACN476; loss of dioxygenase activity and 2-fold lower redox potential.; mutation to E: Loss of dioxygenase activity and lack of iron at the mononuclear site.; mutation to N: Loss of dioxygenase activity.
8h2tB Cryo-em structure of iadd/e dioxygenase bound with iaa (see paper)
28% identity, 85% coverage: 5:392/454 of query aligns to 6:398/435 of 8h2tB
- binding fe (iii) ion: N208 (= N211), H214 (= H217), H219 (= H222), D375 (= D369)
- binding fe2/s2 (inorganic) cluster: C83 (= C88), H85 (= H90), K86 (≠ R91), C104 (= C108), H107 (= H111), W109 (= W113)
- binding 1h-indol-3-ylacetic acid: N208 (= N211), L209 (≠ G212), D211 (= D214), H214 (= H217), P215 (≠ V218), F249 (vs. gap), K320 (≠ M313), Y360 (= Y355)
7ylsB Structure of a bacteria protein complex
28% identity, 85% coverage: 5:392/454 of query aligns to 7:399/436 of 7ylsB
2gbxA Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 bound to biphenyl (see paper)
28% identity, 91% coverage: 25:436/454 of query aligns to 12:416/449 of 2gbxA
- active site: H98 (= H111), D199 (= D214), H202 (= H217), H207 (≠ Y225), D355 (= D369)
- binding biphenyl: D199 (= D214), V203 (= V218), L255 (= L266), H288 (≠ S301), N290 (= N303), L300 (≠ M313)
- binding fe (iii) ion: H202 (= H217), H207 (≠ Y225), D355 (= D369)
- binding fe2/s2 (inorganic) cluster: C75 (= C88), H77 (= H90), R78 (= R91), C95 (= C108), Y97 (≠ F110), H98 (= H111), W100 (= W113)
2gbwA Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 (see paper)
28% identity, 91% coverage: 25:436/454 of query aligns to 12:416/449 of 2gbwA
- active site: H98 (= H111), D199 (= D214), H202 (= H217), H207 (≠ Y225), D355 (= D369)
- binding fe (iii) ion: H202 (= H217), H207 (≠ Y225), D355 (= D369)
- binding fe2/s2 (inorganic) cluster: C75 (= C88), H77 (= H90), R78 (= R91), C95 (= C108), Y97 (≠ F110), H98 (= H111), W100 (= W113)
- binding oxygen molecule: H202 (= H217), F345 (= F359), D355 (= D369)
3en1A Crystal structure of toluene 2,3-dioxygenase (see paper)
28% identity, 80% coverage: 22:382/454 of query aligns to 16:373/424 of 3en1A
- active site: H105 (= H111), D205 (= D214), H208 (= H217), H214 (≠ N224), D360 (= D369)
- binding fe (ii) ion: Q201 (≠ N211), H208 (= H217), H214 (≠ N224), D360 (= D369)
- binding fe2/s2 (inorganic) cluster: C82 (= C88), H84 (= H90), R85 (= R91), C102 (= C108), Y104 (≠ F110), H105 (= H111), W107 (= W113)
- binding toluene: Q201 (≠ N211), F202 (vs. gap), D205 (= D214), H208 (= H217), H295 (≠ N303)
1uliC Biphenyl dioxygenase (bpha1a2) derived from rhodococcus sp. Strain rha1 (see paper)
27% identity, 80% coverage: 22:382/454 of query aligns to 16:363/425 of 1uliC
- active site: H105 (= H111), D205 (= D214), H208 (= H217), H214 (≠ Q231), D350 (= D369)
- binding fe (ii) ion: H208 (= H217), H214 (≠ Q231), D350 (= D369)
- binding fe2/s2 (inorganic) cluster: C82 (= C88), H84 (= H90), R85 (= R91), C102 (= C108), Y104 (≠ F110), H105 (= H111), W107 (= W113)
Q53122 Biphenyl 2,3-dioxygenase subunit alpha; Biphenyl dioxygenase system, oxygenase component subunit alpha; BDO, oxygenase component subunit alpha; Rieske dioxygenase; Terminal oxygenase component of biphenyl dioxygenase, large subunit; EC 1.14.12.18 from Rhodococcus jostii (strain RHA1) (see paper)
26% identity, 83% coverage: 4:382/454 of query aligns to 14:391/460 of Q53122
- C98 (= C88) binding
- H100 (= H90) binding
- C118 (= C108) binding
- H121 (= H111) binding
- 217:230 (vs. 211:223, 21% identical) binding
- H224 (= H217) binding
- H230 (≠ W223) binding
- D378 (= D369) binding
4hm8A Naphthalene 1,2-dioxygenase bound to thioanisole
29% identity, 76% coverage: 24:369/454 of query aligns to 17:362/446 of 4hm8A
- active site: H104 (= H111), D205 (= D214), H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding (methylsulfanyl)benzene: N201 (= N211), H295 (≠ S301)
- binding fe (iii) ion: H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C81 (= C88), H83 (= H90), R84 (= R91), C101 (= C108), Y103 (≠ F110), H104 (= H111), W106 (= W113)
4hm7A Naphthalene 1,2-dioxygenase bound to styrene
29% identity, 76% coverage: 24:369/454 of query aligns to 17:362/446 of 4hm7A
- active site: H104 (= H111), D205 (= D214), H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe (iii) ion: H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C81 (= C88), H83 (= H90), R84 (= R91), C101 (= C108), Y103 (≠ F110), H104 (= H111), W106 (= W113)
- binding ethenylbenzene: N201 (= N211), H208 (= H217), H295 (≠ S301), N297 (= N303)
4hm6A Naphthalene 1,2-dioxygenase bound to phenetole
29% identity, 76% coverage: 24:369/454 of query aligns to 17:362/446 of 4hm6A
- active site: H104 (= H111), D205 (= D214), H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding ethoxybenzene: N201 (= N211), H208 (= H217), H295 (≠ S301)
- binding fe (iii) ion: H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C81 (= C88), H83 (= H90), R84 (= R91), C101 (= C108), Y103 (≠ F110), H104 (= H111), W106 (= W113)
4hm4A Naphthalene 1,2-dioxygenase bound to indan
29% identity, 76% coverage: 24:369/454 of query aligns to 17:362/446 of 4hm4A
- active site: H104 (= H111), D205 (= D214), H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding 2,3-dihydro-1H-indene: H208 (= H217), H295 (≠ S301), N297 (= N303)
- binding fe (iii) ion: H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C81 (= C88), H83 (= H90), R84 (= R91), C101 (= C108), Y103 (≠ F110), H104 (= H111), W106 (= W113)
4hm3A Naphthalene 1,2-dioxygenase bound to ethylbenzene
29% identity, 76% coverage: 24:369/454 of query aligns to 17:362/446 of 4hm3A
- active site: H104 (= H111), D205 (= D214), H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe (iii) ion: H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C81 (= C88), H83 (= H90), R84 (= R91), C101 (= C108), Y103 (≠ F110), H104 (= H111), W106 (= W113)
- binding phenylethane: N201 (= N211), D205 (= D214), H208 (= H217), N297 (= N303)
4hm2A Naphthalene 1,2-dioxygenase bound to ethylphenylsulfide
29% identity, 76% coverage: 24:369/454 of query aligns to 17:362/446 of 4hm2A
- active site: H104 (= H111), D205 (= D214), H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding (ethylsulfanyl)benzene: N201 (= N211), D205 (= D214), V209 (= V218), H295 (≠ S301), N297 (= N303)
- binding fe (iii) ion: H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C81 (= C88), H83 (= H90), R84 (= R91), C101 (= C108), Y103 (≠ F110), H104 (= H111), W106 (= W113)
4hm1A Naphthalene 1,2-dioxygenase bound to 1-indanone
29% identity, 76% coverage: 24:369/454 of query aligns to 17:362/446 of 4hm1A
- active site: H104 (= H111), D205 (= D214), H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding 2,3-dihydro-1H-inden-1-one: N201 (= N211), V209 (= V218), N297 (= N303)
- binding fe (iii) ion: H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C81 (= C88), H83 (= H90), R84 (= R91), C101 (= C108), Y103 (≠ F110), H104 (= H111), W106 (= W113)
4hkvA Naphthalene 1,2-dioxygenase bound to benzamide
29% identity, 76% coverage: 24:369/454 of query aligns to 17:362/446 of 4hkvA
- active site: H104 (= H111), D205 (= D214), H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe (iii) ion: H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C81 (= C88), H83 (= H90), R84 (= R91), C101 (= C108), Y103 (≠ F110), H104 (= H111), W106 (= W113)
- binding benzamide: N201 (= N211), H208 (= H217), H295 (≠ S301), N297 (= N303)
4hjlA Naphthalene 1,2-dioxygenase bound to 1-chloronaphthalene
29% identity, 76% coverage: 24:369/454 of query aligns to 17:362/446 of 4hjlA
- active site: H104 (= H111), D205 (= D214), H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding 1-chloronaphthalene: N201 (= N211), D205 (= D214), H208 (= H217), H295 (≠ S301), N297 (= N303), L307 (≠ M313)
- binding fe (iii) ion: H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C81 (= C88), H83 (= H90), R84 (= R91), C101 (= C108), Y103 (≠ F110), H104 (= H111), W106 (= W113)
2hmoA Crystal structure of naphthalene 1,2-dioxygenase bound to 3- nitrotoluene. (see paper)
29% identity, 76% coverage: 24:369/454 of query aligns to 17:362/446 of 2hmoA
- active site: H104 (= H111), D205 (= D214), H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding 3-nitrotoluene: N201 (= N211), N297 (= N303), W358 (≠ A365)
- binding fe (iii) ion: H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C81 (= C88), H83 (= H90), R84 (= R91), C101 (= C108), Y103 (≠ F110), H104 (= H111), W106 (= W113)
2hmmA Crystal structure of naphthalene 1,2-dioxygenase bound to anthracene (see paper)
29% identity, 76% coverage: 24:369/454 of query aligns to 17:362/446 of 2hmmA
- active site: H104 (= H111), D205 (= D214), H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding anthracene: N201 (= N211), D205 (= D214), H208 (= H217), V209 (= V218), F224 (≠ P242), N297 (= N303)
- binding fe (iii) ion: H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C81 (= C88), H83 (= H90), R84 (= R91), C101 (= C108), Y103 (≠ F110), H104 (= H111), W106 (= W113)
2hmkA Crystal structure of naphthalene 1,2-dioxygenase bound to phenanthrene (see paper)
29% identity, 76% coverage: 24:369/454 of query aligns to 17:362/446 of 2hmkA
- active site: H104 (= H111), D205 (= D214), H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe (iii) ion: H208 (= H217), H213 (≠ Y225), D362 (= D369)
- binding fe2/s2 (inorganic) cluster: C81 (= C88), H83 (= H90), R84 (= R91), C101 (= C108), Y103 (≠ F110), H104 (= H111), W106 (= W113)
- binding phenanthrene: N201 (= N211), D205 (= D214), H208 (= H217), V209 (= V218), F224 (≠ P242), N297 (= N303)
Query Sequence
>Pf1N1B4_5800 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5800
MSLRPEYLHSLLEEDPEQGIYRCKREMFTDPRLFDLEMEHIFEGNWLYLAHESQIPNNND
FYTTTMGRQSIFIARNKDGELNAFINACSHRGAMLCRHKTGNKSTYTCPFHGWTFNNSGK
LLKVKDPAAAGYPASFNCEGSHDLTKVARFESYRGFLFGSLKADVVPLVEHLGESAKIID
MIVDQSTDGLEVLRGSSSYIYEGNWKLTAENGADGYHVSSVHWNYAATQNQRKQREAGDC
NPTMSAGSWAKQGGGFYSFDKGHMLLWTRWANPQDRPLYERRDELARDFGKARADWMIEN
SRNLCLYPNVYLMDQFSSQIRIARPISVNRTEITIYCIAPKGESDHARSSRIRQYEDFFN
VSGMATPDDLEEFRSCQTGYQGSVTAWNDMSRGAEHWVEGADDAAKEIDLHPLLSGVRTE
DEGLFVLQHKYWQQTMLKALAAEQSELIAVEAVQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory