SitesBLAST
Comparing Pf1N1B4_5863 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5863 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
33% identity, 48% coverage: 14:179/349 of query aligns to 61:226/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ I26), G75 (= G28), S76 (≠ G29), G77 (≠ N30), T78 (= T31), G79 (≠ A33), L80 (≠ F34), A83 (≠ R37), C84 (≠ E38), P137 (= P88), G138 (≠ P89), E139 (≠ S90), A142 (= A95), T143 (= T96), G146 (= G99), N147 (≠ M100), S149 (≠ A102), T150 (≠ A103), A152 (≠ L105), G153 (≠ S106), E203 (≠ Y156), G204 (= G157), I209 (≠ L162)
Sites not aligning to the query:
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
25% identity, 84% coverage: 52:345/349 of query aligns to 96:453/454 of 8jdvA
- binding 2-Ketohexanoic acid: R317 (= R247), W321 (≠ F251), H368 (≠ N265), H375 (≠ P272), H413 (= H309)
- binding flavin-adenine dinucleotide: P132 (= P88), G133 (= G92), A134 (≠ E93), G140 (= G99), M141 (= M100), A143 (= A102), T144 (≠ A103), A146 (≠ L105), S147 (= S106), E200 (≠ Y156), G201 (= G157), I206 (≠ L162), W321 (≠ F251), Y322 (≠ N252), E412 (≠ S308), H413 (= H309), N449 (= N341)
- binding manganese (ii) ion: H368 (≠ N265), H375 (≠ P272), E412 (≠ S308)
Sites not aligning to the query:
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
25% identity, 84% coverage: 52:345/349 of query aligns to 96:454/455 of 8jdpA
- binding flavin-adenine dinucleotide: P132 (= P88), G133 (= G92), A134 (≠ E93), G140 (= G99), M141 (= M100), A143 (= A102), T144 (≠ A103), A146 (≠ L105), S147 (= S106), E200 (≠ Y156), G201 (= G157), I206 (≠ L162), H369 (≠ N265), E413 (≠ S308), N450 (= N341)
- binding deaminohydroxyvaline: R319 (vs. gap), H414 (= H309)
Sites not aligning to the query:
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
25% identity, 84% coverage: 52:345/349 of query aligns to 96:454/455 of 8jdxA
- binding flavin-adenine dinucleotide: P132 (= P88), G133 (= G92), A134 (≠ E93), G140 (= G99), M141 (= M100), A143 (= A102), T144 (≠ A103), A146 (≠ L105), S147 (= S106), E200 (≠ Y156), G201 (= G157), I206 (≠ L162), W322 (vs. gap), E413 (≠ S308), H414 (= H309), N450 (= N341)
- binding 3-methyl-2-oxobutanoic acid: R318 (vs. gap), H369 (≠ N265), H376 (≠ P272), H414 (= H309)
- binding manganese (ii) ion: H369 (≠ N265), H376 (≠ P272), E413 (≠ S308)
Sites not aligning to the query:
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
25% identity, 84% coverage: 52:345/349 of query aligns to 96:455/456 of 8jdrA
- binding flavin-adenine dinucleotide: P132 (= P88), G133 (= G92), A134 (≠ E93), G140 (= G99), M141 (= M100), A143 (= A102), T144 (≠ A103), A146 (≠ L105), S147 (= S106), E200 (≠ Y156), G201 (= G157), I206 (≠ L162), Y324 (vs. gap), H370 (≠ N265), E414 (≠ S308), N451 (= N341)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (vs. gap), W323 (vs. gap), H415 (= H309)
Sites not aligning to the query:
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
25% identity, 84% coverage: 52:345/349 of query aligns to 96:455/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (vs. gap), W323 (vs. gap), H370 (≠ N265), H415 (= H309)
- binding flavin-adenine dinucleotide: P132 (= P88), G133 (= G92), A134 (≠ E93), G140 (= G99), M141 (= M100), A143 (= A102), T144 (≠ A103), A146 (≠ L105), S147 (= S106), E200 (≠ Y156), G201 (= G157), I206 (≠ L162), H370 (≠ N265), E414 (≠ S308), N451 (= N341)
Sites not aligning to the query:
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
25% identity, 84% coverage: 52:345/349 of query aligns to 96:455/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (vs. gap), W323 (vs. gap), H415 (= H309)
- binding flavin-adenine dinucleotide: P132 (= P88), G133 (= G92), A134 (≠ E93), G140 (= G99), M141 (= M100), A143 (= A102), T144 (≠ A103), A146 (≠ L105), S147 (= S106), E200 (≠ Y156), G201 (= G157), I206 (≠ L162), Y324 (vs. gap), H370 (≠ N265), E414 (≠ S308), N451 (= N341)
Sites not aligning to the query:
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
25% identity, 84% coverage: 52:345/349 of query aligns to 96:455/456 of 8jdnA
- binding flavin-adenine dinucleotide: P132 (= P88), G133 (= G92), A134 (≠ E93), G140 (= G99), M141 (= M100), A143 (= A102), T144 (≠ A103), A146 (≠ L105), S147 (= S106), E200 (≠ Y156), G201 (= G157), I206 (≠ L162), H370 (≠ N265), E414 (≠ S308), N451 (= N341)
- binding (2R)-2-oxidanylpentanoic acid: R319 (vs. gap), W323 (vs. gap), H415 (= H309)
Sites not aligning to the query:
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
25% identity, 84% coverage: 52:345/349 of query aligns to 96:455/456 of 8jdgA
- binding flavin-adenine dinucleotide: P132 (= P88), G133 (= G92), A134 (≠ E93), G140 (= G99), M141 (= M100), A143 (= A102), T144 (≠ A103), A146 (≠ L105), S147 (= S106), E200 (≠ Y156), G201 (= G157), I206 (≠ L162), H370 (≠ N265), E414 (≠ S308), N451 (= N341)
- binding (2R)-2-oxidanylbutanoic acid: R319 (vs. gap), H415 (= H309)
Sites not aligning to the query:
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
25% identity, 84% coverage: 52:345/349 of query aligns to 96:455/456 of 8jdbA
- binding flavin-adenine dinucleotide: P132 (= P88), G133 (= G92), A134 (≠ E93), G140 (= G99), M141 (= M100), A143 (= A102), T144 (≠ A103), A146 (≠ L105), S147 (= S106), E200 (≠ Y156), G201 (= G157), I206 (≠ L162), Y324 (vs. gap), H370 (≠ N265), E414 (≠ S308), N451 (= N341)
- binding (2R)-2-oxidanyloctanoic acid: R319 (vs. gap), W323 (vs. gap), H415 (= H309)
Sites not aligning to the query:
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
25% identity, 84% coverage: 52:345/349 of query aligns to 96:454/455 of 8jdeA
- binding flavin-adenine dinucleotide: P132 (= P88), G133 (= G92), A134 (≠ E93), G140 (= G99), M141 (= M100), A143 (= A102), T144 (≠ A103), A146 (≠ L105), S147 (= S106), E200 (≠ Y156), G201 (= G157), I206 (≠ L162), W322 (vs. gap), E413 (≠ S308), H414 (= H309), N450 (= N341)
- binding lactic acid: R318 (vs. gap), H369 (≠ N265), H376 (≠ P272), H414 (= H309)
- binding manganese (ii) ion: H369 (≠ N265), H376 (≠ P272), E413 (≠ S308)
Sites not aligning to the query:
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
25% identity, 84% coverage: 52:345/349 of query aligns to 96:455/456 of 8jdsA
- binding flavin-adenine dinucleotide: P132 (= P88), G133 (= G92), A134 (≠ E93), G140 (= G99), M141 (= M100), A143 (= A102), T144 (≠ A103), A146 (≠ L105), S147 (= S106), E200 (≠ Y156), G201 (= G157), I206 (≠ L162), W323 (vs. gap), E414 (≠ S308), H415 (= H309), N451 (= N341)
- binding manganese (ii) ion: H370 (≠ N265), H377 (≠ P272), E414 (≠ S308)
- binding pyruvic acid: R319 (vs. gap), H370 (≠ N265), H377 (≠ P272), H415 (= H309)
Sites not aligning to the query:
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
25% identity, 84% coverage: 52:345/349 of query aligns to 96:454/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R247), H369 (≠ N265), H376 (≠ P272), H414 (= H309)
- binding flavin-adenine dinucleotide: P132 (= P88), G133 (= G92), A134 (≠ E93), G140 (= G99), M141 (= M100), A143 (= A102), T144 (≠ A103), A146 (≠ L105), S147 (= S106), E200 (≠ Y156), G201 (= G157), I206 (≠ L162), W322 (≠ F251), E413 (≠ S308), H414 (= H309), N450 (= N341)
- binding manganese (ii) ion: H369 (≠ N265), H376 (≠ P272), E413 (≠ S308)
Sites not aligning to the query:
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
25% identity, 84% coverage: 52:345/349 of query aligns to 96:453/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (≠ G254), W322 (= W258), H369 (vs. gap), H376 (vs. gap), H413 (= H309)
- binding flavin-adenine dinucleotide: P132 (= P88), G133 (= G92), A134 (≠ E93), G140 (= G99), M141 (= M100), A143 (= A102), T144 (≠ A103), A146 (≠ L105), S147 (= S106), E200 (≠ Y156), G201 (= G157), I206 (≠ L162), W322 (= W258), E412 (≠ S308), H413 (= H309), N449 (= N341)
- binding manganese (ii) ion: H369 (vs. gap), H376 (vs. gap), E412 (≠ S308)
Sites not aligning to the query:
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
25% identity, 84% coverage: 52:345/349 of query aligns to 96:453/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (≠ G254), W322 (= W258), S336 (vs. gap), H369 (vs. gap), H376 (vs. gap), H413 (= H309)
- binding flavin-adenine dinucleotide: P132 (= P88), G133 (= G92), A134 (≠ E93), G140 (= G99), M141 (= M100), A143 (= A102), T144 (≠ A103), A146 (≠ L105), S147 (= S106), E200 (≠ Y156), G201 (= G157), I206 (≠ L162), E412 (≠ S308), N449 (= N341)
- binding manganese (ii) ion: H369 (vs. gap), H376 (vs. gap), E412 (≠ S308)
Sites not aligning to the query:
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
25% identity, 84% coverage: 52:345/349 of query aligns to 96:454/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (≠ L243), W322 (vs. gap), H369 (≠ N265), H376 (≠ P272), H414 (= H309)
- binding flavin-adenine dinucleotide: P132 (= P88), G133 (= G92), A134 (≠ E93), G140 (= G99), M141 (= M100), A143 (= A102), T144 (≠ A103), A146 (≠ L105), S147 (= S106), E200 (≠ Y156), G201 (= G157), I206 (≠ L162), W322 (vs. gap), E413 (≠ S308), N450 (= N341)
- binding manganese (ii) ion: H369 (≠ N265), H376 (≠ P272), E413 (≠ S308)
Sites not aligning to the query:
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
31% identity, 46% coverage: 14:174/349 of query aligns to 64:225/467 of 6lpnB
- binding flavin-adenine dinucleotide: P76 (≠ I26), G78 (= G28), G79 (= G29), N80 (= N30), T81 (= T31), G82 (≠ K32), M83 (≠ A33), G86 (= G36), S87 (≠ R37), L140 (≠ P88), A142 (≠ S90), C146 (≠ A95), H147 (≠ T96), G150 (= G99), N151 (≠ M100), A153 (= A102), T154 (≠ A103), G208 (= G157), I212 (≠ V161), I213 (≠ L162)
Sites not aligning to the query:
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
31% identity, 46% coverage: 14:174/349 of query aligns to 63:224/466 of 6lpxA
- binding flavin-adenine dinucleotide: P75 (≠ I26), Q76 (= Q27), G77 (= G28), G78 (= G29), N79 (= N30), T80 (= T31), G81 (≠ K32), M82 (≠ A33), G85 (= G36), S86 (≠ R37), L139 (≠ P88), G140 (≠ P89), A141 (≠ S90), C145 (≠ A95), G149 (= G99), N150 (≠ M100), A152 (= A102), T153 (≠ A103), G157 (= G107), G207 (= G157), I212 (≠ L162)
Sites not aligning to the query:
- binding 2-oxoglutaric acid: 333, 337, 348, 379, 381, 388, 423
- binding flavin-adenine dinucleotide: 39, 422, 459
- binding zinc ion: 381, 388, 422
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
31% identity, 46% coverage: 14:174/349 of query aligns to 63:224/466 of 6lpuA
- binding flavin-adenine dinucleotide: P75 (≠ I26), G77 (= G28), G78 (= G29), N79 (= N30), T80 (= T31), G81 (≠ K32), G85 (= G36), S86 (≠ R37), L139 (≠ P88), G140 (≠ P89), A141 (≠ S90), C145 (≠ A95), H146 (≠ T96), G148 (= G98), G149 (= G99), N150 (≠ M100), A152 (= A102), T153 (≠ A103), A155 (≠ L105), E206 (≠ Y156), G207 (= G157), I211 (≠ V161), I212 (≠ L162)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 422, 459
- binding (2s)-2-hydroxypentanedioic acid: 333, 337, 348, 379, 381, 388, 423
- binding zinc ion: 381, 388, 422
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
31% identity, 46% coverage: 14:174/349 of query aligns to 63:224/466 of 6lpqA
- binding flavin-adenine dinucleotide: P75 (≠ I26), G77 (= G28), G78 (= G29), N79 (= N30), T80 (= T31), G81 (≠ K32), G85 (= G36), S86 (≠ R37), L139 (≠ P88), G140 (≠ P89), A141 (≠ S90), C145 (≠ A95), H146 (≠ T96), G149 (= G99), N150 (≠ M100), A152 (= A102), T153 (≠ A103), A155 (≠ L105), G157 (= G107), E206 (≠ Y156), G207 (= G157), I211 (≠ V161), I212 (≠ L162)
- binding d-malate: M82 (≠ A33)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 422, 459
- binding d-malate: 333, 337, 348, 379, 381, 388, 422, 423
- binding zinc ion: 381, 388, 422
Query Sequence
>Pf1N1B4_5863 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5863
MPDFDASGALLEQVKQARENATPLRIQGGNTKAFLGREVAGEILDTRAHRGIVSYDPTEL
VISVRAGTPLSELFAALDAKGQMLPCEPPSFGEGATVGGMIAAGLSGPRRPWSGSVRDFV
LGTRVISGLGTHLRFGGEVMKNVAGYDLSRLMVGSYGCLGVLTEVSLKVLPKPRQCLSIS
LDIDCARALENLAQWGQQPLPISAACHDGQRLYLRLEGGEGSVTAAHQRLGGEPLDSDYW
ADLNEQRLDFFNEGLPLWRLSLPNNLGPLDLPGEQLIDWGGAQRWLKSGADNIQSRALEL
GGHATCFSHGVSETPFQPLAPALLRYHRQLKAQLDPQGLFNPGRMYAEL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory