Comparing Pf1N1B4_5865 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5865 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
Q88CC1 2-oxoadipate dioxygenase/decarboxylase; 2-hydroxyglutarate synthase; EC 1.13.11.93 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
66% identity, 100% coverage: 1:462/463 of query aligns to 1:464/464 of Q88CC1
6w1hA Crystal structure of the hydroxyglutarate synthase in complex with 2- oxoadipate from pseudomonas putida (see paper)
66% identity, 98% coverage: 5:459/463 of query aligns to 3:450/450 of 6w1hA
2rjbA Crystal structure of uncharacterized protein ydcj (sf1787) from shigella flexneri which includes domain duf1338. Northeast structural genomics consortium target sfr276
53% identity, 97% coverage: 5:453/463 of query aligns to 2:416/418 of 2rjbA
2rjbD Crystal structure of uncharacterized protein ydcj (sf1787) from shigella flexneri which includes domain duf1338. Northeast structural genomics consortium target sfr276
52% identity, 95% coverage: 7:446/463 of query aligns to 1:371/372 of 2rjbD
2rjbC Crystal structure of uncharacterized protein ydcj (sf1787) from shigella flexneri which includes domain duf1338. Northeast structural genomics consortium target sfr276
51% identity, 97% coverage: 7:453/463 of query aligns to 1:362/364 of 2rjbC
>Pf1N1B4_5865 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5865
MSHPNFISPDLIRQRFSKAMSDMYREEVPLYGALMELVEQTNRHVLDSDPQIARQLHSTG
EIQRLDLERHGAIRVGTAAELSTLARLFAVMGMQPVGYYDLTPAGVPVHSTAFRAVHEAA
LQVSPFRVFTSLLRLELIEDAELRAFAQSVLDTRSIFTPAALALIERAETQGGLTEYEAQ
DFVAQALETFRWHHSATVTAEQYQQLSAQHRLIADVVAFKGPHINHLTPRTLDIDIVQAQ
MPAHGITPKAVIEGPPRRQCPILLRQTSFKALDEPITFTDQAQTRGSHSARFGEIEQRGA
ALTPKGRALYDRLLNAARDELKDFPNEANAARYNALMTQHFGEFPDTVEDMRQQELAFFR
YFVTEKGLAAKGLNGVSLEDLLRDGYVRVEPLVYEDFLPVSAAGIFQSNLGDAAQTHYGV
HSNQQAFEKALGRSTIDELGLYAETQRRSVDECCKTLGLPSLT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory