Comparing Pf1N1B4_595 Glucose ABC transport system, inner membrane component 1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
28% identity, 84% coverage: 29:292/314 of query aligns to 6:264/285 of 7cagA
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
25% identity, 82% coverage: 29:287/314 of query aligns to 28:286/313 of P94529
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
23% identity, 63% coverage: 95:292/314 of query aligns to 271:479/490 of 4ki0F
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
23% identity, 63% coverage: 95:292/314 of query aligns to 286:494/514 of P02916
>Pf1N1B4_595 Glucose ABC transport system, inner membrane component 1
VPISFLFTWIIPMSSVAVFSKASPFDALQRWLPKLVLAPSMLIVLVGFYGYIIWTFVLSF
TNSSFMPSYKWVGLQQYIRLMDNDRWWVASKNLAVFGGMFIGISLVLGVFLAVLLDQRIR
KEGFIRTVYLYPMALSMIVTGTAWKWLLNPGLGLDKMLRDWGWEGFRLDWLVDQDRVVYC
LVIAAVWQASGFVMAMFLAGLRGVDQSIIRAAQVDGASLPTIYLKIVLPSLRPVFFSAFM
ILAHIAIKSFDLVAAMTAGGPGYSSDLPAMFMYSFTFSRGQMGIGSASAMMMLGAILAIL
VPYLYSELRGKRHE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory