SitesBLAST
Comparing Pf1N1B4_5977 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5977 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 46% coverage: 18:230/465 of query aligns to 40:259/583 of Q9Y7Q9
Sites not aligning to the query:
- 267 modified: Phosphoserine
- 269 modified: Phosphoserine
- 289 modified: Phosphoserine
- 290 modified: Phosphoserine
- 292 modified: Phosphoserine
- 330 modified: Phosphoserine
8et8A Cryo-em structure of the organic cation transporter 1 in complex with verapamil (see paper)
24% identity, 85% coverage: 54:446/465 of query aligns to 127:532/532 of 8et8A
- binding (2S)-2-(3,4-dimethoxyphenyl)-5-{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino}-2-(propan-2-yl)pentanenitrile: K213 (≠ G137), W216 (= W140), Q240 (= Q164), W353 (≠ V267), Y360 (= Y274), F378 (≠ M290), S381 (≠ A293), E385 (≠ H297), C449 (≠ S362), S469 (≠ Y382)
Sites not aligning to the query:
8et7A Cryo-em structure of the organic cation transporter 1 in complex with diphenhydramine (see paper)
24% identity, 85% coverage: 54:446/465 of query aligns to 127:532/532 of 8et7A
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
25% identity, 50% coverage: 18:250/465 of query aligns to 39:255/444 of Q8NLB7
- D54 (≠ E30) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (≠ E33) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (≠ K87) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
22% identity, 88% coverage: 41:449/465 of query aligns to 23:443/446 of A0A0H2VG78
- R102 (= R129) mutation to A: Loss of transport activity.
- I105 (≠ Q132) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E149) mutation to A: Loss of transport activity.
- Q137 (= Q164) mutation to A: Loss of transport activity.
- Q250 (≠ A259) mutation to A: Loss of transport activity.
- Q251 (≠ E260) mutation to A: Loss of transport activity.
- N256 (≠ Y265) mutation to A: Loss of transport activity.
- W357 (vs. gap) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
O15245 Solute carrier family 22 member 1; Organic cation transporter 1; hOCT1 from Homo sapiens (Human) (see 10 papers)
25% identity, 85% coverage: 54:448/465 of query aligns to 128:535/554 of O15245
- L160 (= L72) to F: no changes in both MPP(+) and TEA uptake; abolishes MPP(+) uptake when associated with S-401; largely localized to the plasma membrane; dbSNP:rs683369
- S189 (≠ T104) to L: no changes in MPP(+) uptake; dbSNP:rs34104736
- G220 (≠ A143) to V: affects transporter activity; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs36103319
- Y240 (≠ P163) mutation to F: Decreased TEA uptake.
- P283 (≠ D217) to L: in dbSNP:rs4646277; mutation to A: Decreased TEA uptake.
- R287 (≠ I221) to G: in dbSNP:rs4646278
- P341 (≠ I254) to L: affects transporter activity; reduction of TEA uptake; reduction o MPP(+) uptake when associated with V-408; largely localized to the plasma membrane; dbSNP:rs2282143
- R342 (≠ G255) to H: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34205214
- Y361 (= Y274) mutation to F: Decreased TEA uptake.
- Y376 (≠ L288) mutation to F: Decreased TEA uptake.
- G401 (= G312) to S: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; no MPP(+) uptake when associated with L-160; dbSNP:rs34130495
- M408 (≠ L318) to V: does not affect transporter activity; no changes in MPP(+) uptake when associated with F-14; no changes in MPP(+) uptake when associated with F-85; no changes in MPP(+) uptake when associated with L-189; no changes in MPP(+) uptake when associated with H-342; no changes in MPP(+) uptake when associated with M-420 del; no changes in MPP(+) uptake when associated with I-440; no changes in MPP(+) uptake when associated with I-461; no changes in MPP(+) uptake when associated with M-488; reduction of MPP uptake when associated with C-61; no MPP(+) uptake when associated with V-220; reduction of MPP(+) uptake when associated with L-341; no MPP(+) uptake when associated with S-401; no MPP(+) uptake when associated with R-465; dbSNP:rs628031
- M420 (≠ V330) natural variant: Missing (reduction of serum O-isobutanoyl-(R)-carnitine levels; no change in MPP(+) uptake; no changes in MPP(+) uptake when associated with V-408; dbSNP:rs72552763)
- M440 (≠ E354) to I: in dbSNP:rs35956182
- V461 (= V373) to I: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34295611
- G465 (≠ A377) to R: reduction of the localization to the basolateral membrane; no MPP(+) uptake when associated with V-408; dbSNP:rs34059508; mutation to A: No changes in MPP(+) uptake.
- R488 (≠ L401) to M: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs35270274
Sites not aligning to the query:
- 14 S → F: exclusively found in the African American population; increased MPP(+) uptake when associated with V-408; dbSNP:rs34447885
- 24 I→L: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 28 L→I: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 31 A→S: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 32 F→L: No change in fenoterol uptake. Decreased trospium uptake. Decreased trospium affinity.
- 36 C→Y: Increased fenoterol uptake. Increased fenoterol affinity. No change in trospium uptake. No change in terbutaline uptake. No change in terbutaline affinity.
- 41 F → L: in dbSNP:rs2297373
- 61 R → C: affects transporter activity; reduction of MPP(+) uptake; reduction of serum O-isobutanoyl-(R)-carnitine levels; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs12208357
- 85 L → F: no changes in MPP(+) uptake; when associated with V-408; dbSNP:rs35546288
- 88 C → R: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; dbSNP:rs55918055
P32037 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Mus musculus (Mouse) (see paper)
29% identity, 27% coverage: 51:176/465 of query aligns to 49:171/493 of P32037
Sites not aligning to the query:
- 43 modified: carbohydrate, N-linked (GlcNAc...) asparagine
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
21% identity, 79% coverage: 76:441/465 of query aligns to 70:476/491 of P0AGF4
- G83 (= G89) mutation to A: Abolishes xylose transport.
- R133 (= R129) mutation R->C,H,L: Abolishes xylose transport.
- E153 (= E149) mutation to A: Abolishes xylose transport.
- R160 (= R156) mutation to A: Abolishes xylose transport.
- Q168 (= Q164) binding ; mutation to A: Abolishes xylose transport.
- Q288 (≠ A256) mutation to A: Abolishes xylose transport.
- QQ 288:289 (≠ AR 256:257) binding
- Q289 (≠ R257) mutation to A: Strongly decreases xylose transport.
- N294 (≠ E260) binding ; mutation to A: Abolishes xylose transport.
- Y298 (= Y264) mutation to A: Abolishes xylose transport.
- N325 (≠ L295) mutation to A: No effect on xylose transport.
- G340 (= G312) mutation to A: Abolishes xylose transport.
- R341 (= R313) mutation R->A,W: Abolishes xylose transport.
- W392 (vs. gap) binding ; mutation to A: Abolishes xylose transport.
- E397 (= E367) mutation to A: Abolishes xylose transport.
- R404 (= R374) mutation to A: Strongly decreases xylose transport.
- Q415 (vs. gap) binding
- W416 (vs. gap) mutation to A: Strongly decreases xylose transport.
Sites not aligning to the query:
- 24 F→A: Decreases xylose transport.
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
32% identity, 16% coverage: 82:157/465 of query aligns to 78:145/452 of Q5EXK5
- D82 (= D86) mutation to A: Loss of activity.
Sites not aligning to the query:
- 311 V→W: Loss of activity.
- 314 D→A: Loss of activity.
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
21% identity, 79% coverage: 76:441/465 of query aligns to 66:472/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
21% identity, 79% coverage: 76:441/465 of query aligns to 66:472/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
21% identity, 79% coverage: 76:441/465 of query aligns to 66:472/475 of 4gbyA
Query Sequence
>Pf1N1B4_5977 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5977
MSNPLHTQSATTPSGLKRVVAAAMAGTVAEWYEFFLYGTASALVFGQLFFRQTDSPIDGI
IAAFALYAVGFLARPLGGLVFGHYGDKFGRKRLLQLSLVVVGITTFLMGCLPGFDQIGYA
APVLLVLLRLIQGFAFGGEWGGAILLVSEHCPDNRRGFWASWPQAGVPAGNLVATVALLL
LSSNLSEEQFLAWGWRVAFWFSAVVVLIGYWIRTSVDDAPIFKEAQARQAQIKQQQLGVV
EVLRHHWRAVLVGIGARFAENILYYTVVTFSITYLKLVVHKDTSEILLLMFGAHLVHFFL
IPLMGYLSDIVGRKPVYLTGAVLTAFWGFVGFPMMDTGNNWLIMAAIILGLGIESMTYAP
YSALMAEMFPTHVRYTALSLCYQVAPIFAGSLAPLIAITLLNKYHSSTPIAWYLVGAALI
SIVAVGLTRETRGKSLHLVDAESAARIAALDSAVPAMARRGDSLV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory