Comparing Pf1N1B4_6 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_6 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
1lbmA Crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5- phosphate (rcdrp) (see paper)
44% identity, 88% coverage: 4:130/145 of query aligns to 2:128/194 of 1lbmA
Sites not aligning to the query:
1nsjA Crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima (see paper)
45% identity, 87% coverage: 4:129/145 of query aligns to 2:127/205 of 1nsjA
Sites not aligning to the query:
1piiA Three-dimensional structure of the bifunctional enzyme phosphoribosylanthranilate isomerase: indoleglycerolphosphate synthase from escherichia coli refined at 2.0 angstroms resolution (see paper)
37% identity, 69% coverage: 6:105/145 of query aligns to 257:346/452 of 1piiA
Sites not aligning to the query:
>Pf1N1B4_6 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_6
MSAVRSKICGITRIEDALAAVEAGADAIGFVFYAKSPRAVTVQQARAIIKALPPFVTTVG
LFVNASRCELGEILDAVPLDLLQFHGDETAADCEGWHRPYIKALRVKAGDDIAAACDAYA
SASGILLDTYVEGVPGEPVKRSTGH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory