Comparing Pf1N1B4_600 Glucokinase (EC 2.7.1.2) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
1sz2B Crystal structure of e. Coli glucokinase in complex with glucose (see paper)
39% identity, 99% coverage: 2:317/319 of query aligns to 2:316/320 of 1sz2B
6da0A Crystal structure of glucokinase (nfhk) from naegleria fowleri (see paper)
24% identity, 84% coverage: 8:274/319 of query aligns to 32:330/378 of 6da0A
5brfA Crystal structure of trypanosoma cruzi glucokinase in complex with inhibitor hpop-glcn (see paper)
25% identity, 76% coverage: 3:244/319 of query aligns to 24:286/364 of 5brfA
Sites not aligning to the query:
5brhA Crystal structure of trypanosoma cruzi glucokinase in complex with inhibitor dbt-glcn (see paper)
26% identity, 76% coverage: 3:244/319 of query aligns to 24:289/367 of 5brhA
5breA Crystal structure of trypanosoma cruzi glucokinase in complex with inhibitor cbz-glcn (see paper)
26% identity, 76% coverage: 3:244/319 of query aligns to 24:289/367 of 5breA
5brdA Crystal structure of trypanosoma cruzi glucokinase in complex with inhibitor benz-glcn (see paper)
26% identity, 76% coverage: 3:244/319 of query aligns to 24:289/367 of 5brdA
>Pf1N1B4_600 Glucokinase (EC 2.7.1.2)
LKLALVGDIGGTNARFALWKNQQLESVQVLATADHASPEEAIALYLSGLGLAPGSIGSVC
LSVAGPVSGDEFKFTNNHWRLSRQGFCKTLQVDQLLLVNDFSAMALGMTRLQPGEFRVVC
EGTPEPLRPAVVIGPGTGLGVGTLLDLGEGRFAPLPGEGGHVDLPLSSPRETQLWQHIFN
EIGHVSAETALSGSGLPRVYRAICAVDGHTPVLDTPEAITKAGLAGDPIALEVLEQFCCW
LGRVAGNNVLTTGARGGVYIVGGVIPRFADFFIESGFARCFADKGCMSDYFKGIPVWLVT
APYSGLVGAGVALEQSIPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory