Comparing Pf1N1B4_686 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_686 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
24% identity, 80% coverage: 88:439/439 of query aligns to 63:434/446 of A0A0H2VG78
Sites not aligning to the query:
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 70% coverage: 78:384/439 of query aligns to 186:499/616 of P36035
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 35% coverage: 82:235/439 of query aligns to 98:258/583 of Q9Y7Q9
Sites not aligning to the query:
Q6PXP3 Solute carrier family 2, facilitated glucose transporter member 7; Glucose transporter type 7; GLUT-7; hGLUT7 from Homo sapiens (Human) (see paper)
19% identity, 79% coverage: 92:439/439 of query aligns to 100:478/512 of Q6PXP3
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
23% identity, 49% coverage: 21:237/439 of query aligns to 37:231/444 of Q8NLB7
Sites not aligning to the query:
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 41% coverage: 82:260/439 of query aligns to 117:317/587 of P25297
Sites not aligning to the query:
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
23% identity, 55% coverage: 92:332/439 of query aligns to 93:359/580 of Q9C757
Sites not aligning to the query:
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
25% identity, 85% coverage: 67:437/439 of query aligns to 50:398/403 of P77589
Sites not aligning to the query:
O42885 Putative inorganic phosphate transporter C8E4.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 54% coverage: 3:238/439 of query aligns to 18:270/572 of O42885
Sites not aligning to the query:
8fvzA Pipt y150a
25% identity, 45% coverage: 24:219/439 of query aligns to 2:200/433 of 8fvzA
Sites not aligning to the query:
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
25% identity, 39% coverage: 82:252/439 of query aligns to 203:380/727 of Q496J9
Sites not aligning to the query:
P14672 Solute carrier family 2, facilitated glucose transporter member 4; Glucose transporter type 4, insulin-responsive; GLUT-4 from Homo sapiens (Human) (see 6 papers)
24% identity, 38% coverage: 15:180/439 of query aligns to 15:187/509 of P14672
Sites not aligning to the query:
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
38% identity, 17% coverage: 88:163/439 of query aligns to 78:145/452 of Q5EXK5
Sites not aligning to the query:
Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
26% identity, 33% coverage: 93:237/439 of query aligns to 108:251/514 of Q9LT15
Sites not aligning to the query:
7aaqA Sugar/h+ symporter stp10 in outward occluded conformation (see paper)
26% identity, 33% coverage: 93:237/439 of query aligns to 88:231/487 of 7aaqA
Sites not aligning to the query:
A2SWM2 Sphingosine-1-phosphate transporter SPNS2; Protein spinster homolog 2; Protein two of hearts from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
28% identity, 38% coverage: 245:412/439 of query aligns to 45:213/504 of A2SWM2
8sc6A Human oct1 bound to thiamine in inward-open conformation (see paper)
36% identity, 20% coverage: 76:162/439 of query aligns to 140:215/447 of 8sc6A
Sites not aligning to the query:
Q09852 Putative inorganic phosphate transporter C23D3.12 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 40% coverage: 54:230/439 of query aligns to 82:258/559 of Q09852
Sites not aligning to the query:
8sc3A Human oct1 bound to fenoterol in inward-open conformation (see paper)
36% identity, 20% coverage: 76:162/439 of query aligns to 140:216/445 of 8sc3A
Sites not aligning to the query:
8sc2A Human oct1 bound to diltiazem in inward-open conformation (see paper)
36% identity, 20% coverage: 76:162/439 of query aligns to 140:216/453 of 8sc2A
Sites not aligning to the query:
>Pf1N1B4_686 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_686
MDNSNTLPLGSAALPVKEKTTASRIKSIFSGSVGNMVEWYDWYVYAAFSLYFAKTFFPAG
SSTAQLMNTAAIFAVGFLMRPIGGWLMGLYADRAGRKRALMASVYLMCFGSLLIALSPNY
ETIGIGAPILLVFARLLQGLSVGGEYGTSATYLSEMATKERRGFYSSFQYVTLISGQLIA
LAVLIVLQQTLTTEQLYAWGWRIPFAIGALCAVVALYLRRGMEETESFTKKVKAKESAMR
TLMRHPKELMTVVGLTMGGTLAFYTYTTYMQKYLVNTVGMSITDSTSISAATLFLFMCLQ
PIVGGLSDKVGRRPILIAFGILGTLFTVPILTTLHTVQTWWGAFFLIMAALIIVSGYTSI
NAVVKAELFPTEIRALGVGLPYALTVSIFGGTAEYIALWFKSIGMETGYYWYVTACIAVS
LLVYITMKDTRKHSRIETD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory