SitesBLAST
Comparing Pf1N1B4_696 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_696 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6lpiB Crystal structure of ahas holo-enzyme (see paper)
32% identity, 98% coverage: 3:534/545 of query aligns to 7:517/539 of 6lpiB
- active site: I27 (= I23), G29 (= G25), G30 (≠ V26), S31 (≠ H27), I32 (≠ T28), E53 (= E48), C76 (≠ I71), F115 (≠ L112), Q116 (≠ H113), E117 (= E114), K165 (≠ L163), M256 (≠ T251), A283 (≠ D280), V375 (≠ S383), G401 (= G410), M403 (≠ L412), D428 (= D442), N455 (= N469), A457 (≠ G471), L458 (≠ Y472), L460 (≠ E474), V461 (≠ I475), Q464 (≠ Y478)
- binding flavin-adenine dinucleotide: R155 (= R153), G212 (= G209), G213 (= G210), G214 (= G211), T236 (= T233), L237 (≠ I234), M238 (≠ N235), L254 (vs. gap), M256 (≠ T251), H257 (≠ Q252), G276 (= G271), A277 (≠ T272), R278 (≠ E273), D280 (≠ T277), R282 (≠ Y279), A283 (≠ D280), D300 (= D297), I301 (= I298), D319 (= D316), V320 (≠ S317), M380 (≠ Y388), G398 (≠ S406)
- binding magnesium ion: D428 (= D442), N455 (= N469)
- binding thiamine diphosphate: E53 (= E48), C76 (≠ I71), P79 (= P74), G376 (≠ T384), Q377 (= Q385), H378 (≠ P386), G401 (= G410), M403 (≠ L412), G427 (= G441), D428 (= D442), G429 (= G443), S430 (≠ G444), M433 (≠ F447), N455 (= N469), A457 (≠ G471), L458 (≠ Y472), G459 (≠ E473), L460 (≠ E474), V461 (≠ I475)
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
30% identity, 97% coverage: 6:534/545 of query aligns to 16:554/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (≠ S250), R292 (≠ T282), W489 (vs. gap)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ D382), G401 (≠ S383), Q402 (≠ T384), H403 (≠ Q385), G426 (= G410), M428 (≠ L412), G452 (= G441), D453 (= D442), G454 (= G443), S455 (≠ G444), L483 (≠ Y472), G484 (≠ E473), M485 (vs. gap), V486 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G209), G223 (= G210), G224 (= G211), T246 (= T233), L247 (≠ I234), M248 (≠ N235), M263 (≠ L247), L264 (≠ I248), M266 (≠ S250), H267 (≠ T251), G286 (= G271), R288 (≠ E273), V293 (≠ F283), D310 (= D297), I311 (= I298), D329 (= D316), V330 (≠ S317), M405 (≠ V387), G423 (≠ T407)
- binding magnesium ion: A37 (≠ H27), T82 (≠ I71), S83 (≠ T72), Q122 (≠ H113), Y381 (vs. gap), D453 (= D442), M458 (≠ F447), Q461 (≠ P450), N480 (= N469), H482 (≠ G471), K533 (≠ V513)
Sites not aligning to the query:
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
30% identity, 97% coverage: 6:534/545 of query aligns to 15:553/582 of 3ea4A
- active site: Y32 (≠ I23), G34 (= G25), G35 (≠ V26), A36 (≠ H27), S37 (≠ T28), E58 (= E48), T81 (≠ I71), F120 (≠ L112), Q121 (≠ H113), E122 (= E114), K170 (≠ L163), M265 (≠ S250), V292 (≠ F283), V399 (≠ D382), G425 (= G410), M427 (≠ L412), D452 (= D442), N479 (= N469), H481 (≠ G471), L482 (≠ Y472), M484 (vs. gap), V485 (vs. gap), W488 (vs. gap)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (≠ I281), R291 (≠ T282), W488 (vs. gap)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R153), G221 (= G209), G222 (= G210), G223 (= G211), T245 (= T233), L246 (≠ I234), M247 (≠ N235), L263 (≠ I248), G264 (= G249), M265 (≠ S250), H266 (≠ T251), G285 (= G271), R287 (≠ E273), D289 (= D280), R291 (≠ T282), D309 (= D297), I310 (= I298), G327 (≠ A315), D328 (= D316), V329 (≠ S317), M404 (≠ V387), G422 (≠ T407)
- binding magnesium ion: D452 (= D442), N479 (= N469), H481 (≠ G471)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (≠ D382), G400 (≠ S383), Q401 (≠ T384), H402 (≠ Q385), M427 (≠ L412), G451 (= G441), D452 (= D442), G453 (= G443), S454 (≠ G444), N479 (= N469), H481 (≠ G471), L482 (≠ Y472), G483 (≠ E473), M484 (vs. gap), V485 (vs. gap)
Sites not aligning to the query:
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
30% identity, 97% coverage: 6:534/545 of query aligns to 15:553/582 of 3e9yA
- active site: Y32 (≠ I23), G34 (= G25), G35 (≠ V26), A36 (≠ H27), S37 (≠ T28), E58 (= E48), T81 (≠ I71), F120 (≠ L112), Q121 (≠ H113), E122 (= E114), K170 (≠ L163), M265 (≠ S250), V292 (≠ F283), V399 (≠ D382), G425 (= G410), M427 (≠ L412), D452 (= D442), N479 (= N469), H481 (≠ G471), L482 (≠ Y472), M484 (vs. gap), V485 (vs. gap), W488 (vs. gap)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (≠ I281), R291 (≠ T282), W488 (vs. gap)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R153), G221 (= G209), G222 (= G210), G223 (= G211), T245 (= T233), L246 (≠ I234), M247 (≠ N235), L263 (≠ I248), G285 (= G271), R287 (≠ E273), D289 (= D280), R291 (≠ T282), D309 (= D297), I310 (= I298), G327 (≠ A315), D328 (= D316), V329 (≠ S317), M404 (≠ V387), G422 (≠ T407)
- binding magnesium ion: D452 (= D442), N479 (= N469), H481 (≠ G471)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (≠ D382), G400 (≠ S383), Q401 (≠ T384), H402 (≠ Q385), M427 (≠ L412), G451 (= G441), G453 (= G443), S454 (≠ G444), N479 (= N469), H481 (≠ G471), L482 (≠ Y472), G483 (≠ E473), M484 (vs. gap), V485 (vs. gap)
Sites not aligning to the query:
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
30% identity, 97% coverage: 6:534/545 of query aligns to 16:554/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ D382), G401 (≠ S383), Q402 (≠ T384), H403 (≠ Q385), G426 (= G410), M428 (≠ L412), G452 (= G441), D453 (= D442), G454 (= G443), S455 (≠ G444), M458 (≠ F447), N480 (= N469), H482 (≠ G471), L483 (≠ Y472), G484 (≠ E473), M485 (vs. gap), V486 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G209), G223 (= G210), G224 (= G211), T246 (= T233), L247 (≠ I234), M248 (≠ N235), L264 (≠ I248), M266 (≠ S250), H267 (≠ T251), G286 (= G271), V287 (≠ T272), R288 (≠ E273), D290 (= D280), R292 (≠ T282), V293 (≠ F283), D310 (= D297), I311 (= I298), D329 (= D316), V330 (≠ S317), M405 (≠ V387), G423 (≠ T407)
- binding magnesium ion: F370 (≠ Q363), D453 (= D442), M458 (≠ F447), Q461 (≠ P450), N480 (= N469), H482 (≠ G471), K533 (≠ V513)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (≠ S250), R292 (≠ T282), M485 (vs. gap), W489 (vs. gap)
Sites not aligning to the query:
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
30% identity, 97% coverage: 6:534/545 of query aligns to 16:554/582 of 5wj1A
- active site: Y33 (≠ I23), G35 (= G25), G36 (≠ V26), A37 (≠ H27), S38 (≠ T28), E59 (= E48), T82 (≠ I71), F121 (≠ L112), Q122 (≠ H113), E123 (= E114), K171 (≠ L163), M266 (≠ S250), V293 (≠ F283), V400 (≠ D382), G426 (= G410), M428 (≠ L412), D453 (= D442), N480 (= N469), H482 (≠ G471), L483 (≠ Y472), M485 (vs. gap), V486 (vs. gap), W489 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G209), G223 (= G210), G224 (= G211), T246 (= T233), L247 (≠ I234), M248 (≠ N235), M263 (≠ L247), L264 (≠ I248), G286 (= G271), R288 (≠ E273), V293 (≠ F283), D310 (= D297), I311 (= I298), D329 (= D316), V330 (≠ S317), M405 (≠ V387), G423 (≠ T407), G424 (= G408)
- binding magnesium ion: D453 (= D442), N480 (= N469), H482 (≠ G471)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (≠ S250), D291 (≠ I281), R292 (≠ T282), M485 (vs. gap), W489 (vs. gap)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ D382), G401 (≠ S383), Q402 (≠ T384), H403 (≠ Q385), M428 (≠ L412), D453 (= D442), G454 (= G443), S455 (≠ G444), M458 (≠ F447), N480 (= N469), H482 (≠ G471), L483 (≠ Y472), G484 (≠ E473), M485 (vs. gap), V486 (vs. gap)
Sites not aligning to the query:
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
30% identity, 97% coverage: 6:534/545 of query aligns to 16:554/582 of 5k6tA
- active site: Y33 (≠ I23), G35 (= G25), G36 (≠ V26), A37 (≠ H27), S38 (≠ T28), E59 (= E48), T82 (≠ I71), F121 (≠ L112), Q122 (≠ H113), E123 (= E114), K171 (≠ L163), M266 (≠ S250), V293 (≠ F283), V400 (≠ D382), G426 (= G410), M428 (≠ L412), D453 (= D442), N480 (= N469), H482 (≠ G471), L483 (≠ Y472), M485 (vs. gap), V486 (vs. gap), W489 (vs. gap)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (≠ T251), R292 (≠ T282), M485 (vs. gap), W489 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G209), G223 (= G210), G224 (= G211), T246 (= T233), L247 (≠ I234), M248 (≠ N235), L264 (≠ I248), G286 (= G271), R288 (≠ E273), D290 (= D280), R292 (≠ T282), V293 (≠ F283), D310 (= D297), I311 (= I298), D329 (= D316), V330 (≠ S317), Q404 (≠ P386), M405 (≠ V387), G423 (≠ T407)
- binding magnesium ion: D453 (= D442), N480 (= N469), H482 (≠ G471)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ D382), G401 (≠ S383), Q402 (≠ T384), H403 (≠ Q385), G426 (= G410), M428 (≠ L412), G452 (= G441), G454 (= G443), S455 (≠ G444), N480 (= N469), H482 (≠ G471), L483 (≠ Y472), G484 (≠ E473)
Sites not aligning to the query:
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
30% identity, 97% coverage: 6:534/545 of query aligns to 16:554/582 of 5k6rA
- active site: Y33 (≠ I23), G35 (= G25), G36 (≠ V26), A37 (≠ H27), S38 (≠ T28), E59 (= E48), T82 (≠ I71), F121 (≠ L112), Q122 (≠ H113), E123 (= E114), K171 (≠ L163), M266 (≠ S250), V293 (≠ F283), V400 (≠ D382), G426 (= G410), M428 (≠ L412), D453 (= D442), N480 (= N469), H482 (≠ G471), L483 (≠ Y472), M485 (vs. gap), V486 (vs. gap), W489 (vs. gap)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (≠ T282), W489 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G209), G223 (= G210), G224 (= G211), T246 (= T233), L247 (≠ I234), M248 (≠ N235), L264 (≠ I248), M266 (≠ S250), G286 (= G271), R288 (≠ E273), R292 (≠ T282), V293 (≠ F283), D310 (= D297), I311 (= I298), G328 (≠ A315), D329 (= D316), V330 (≠ S317), M405 (≠ V387), G423 (≠ T407)
- binding magnesium ion: D453 (= D442), N480 (= N469), H482 (≠ G471)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ D382), G401 (≠ S383), Q402 (≠ T384), H403 (≠ Q385), G426 (= G410), M428 (≠ L412), D453 (= D442), G454 (= G443), S455 (≠ G444), M458 (≠ F447), N480 (= N469), H482 (≠ G471), L483 (≠ Y472), G484 (≠ E473), M485 (vs. gap), V486 (vs. gap)
Sites not aligning to the query:
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
30% identity, 97% coverage: 6:534/545 of query aligns to 16:554/582 of 1z8nA
- active site: Y33 (≠ I23), G35 (= G25), G36 (≠ V26), A37 (≠ H27), S38 (≠ T28), E59 (= E48), T82 (≠ I71), F121 (≠ L112), Q122 (≠ H113), E123 (= E114), K171 (≠ L163), M266 (≠ S250), V293 (≠ F283), V400 (≠ D382), G426 (= G410), M428 (≠ L412), D453 (= D442), N480 (= N469), H482 (≠ G471), L483 (≠ Y472), M485 (vs. gap), V486 (vs. gap), W489 (vs. gap)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (≠ A127), R161 (= R153), Y191 (≠ N180), R194 (= R183), D291 (≠ I281), R292 (≠ T282), D312 (= D299), W489 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G209), G224 (= G211), T246 (= T233), L247 (≠ I234), M248 (≠ N235), L264 (≠ I248), G265 (= G249), M266 (≠ S250), H267 (≠ T251), G286 (= G271), V287 (≠ T272), R288 (≠ E273), D290 (= D280), R292 (≠ T282), V293 (≠ F283), D310 (= D297), I311 (= I298), D329 (= D316), V330 (≠ S317), M405 (≠ V387), G423 (≠ T407), G424 (= G408)
- binding magnesium ion: D453 (= D442), N480 (= N469)
- binding thiamine diphosphate: V400 (≠ D382), G401 (≠ S383), Q402 (≠ T384), H403 (≠ Q385), G426 (= G410), M428 (≠ L412), G452 (= G441), G454 (= G443), S455 (≠ G444), N480 (= N469), H482 (≠ G471), L483 (≠ Y472), G484 (≠ E473), M485 (vs. gap), V486 (vs. gap)
Sites not aligning to the query:
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
30% identity, 97% coverage: 6:534/545 of query aligns to 16:554/582 of 1yi1A
- active site: Y33 (≠ I23), G35 (= G25), G36 (≠ V26), A37 (≠ H27), S38 (≠ T28), E59 (= E48), T82 (≠ I71), F121 (≠ L112), Q122 (≠ H113), E123 (= E114), K171 (≠ L163), M266 (≠ S250), V293 (≠ F283), V400 (≠ D382), G426 (= G410), M428 (≠ L412), D453 (= D442), N480 (= N469), H482 (≠ G471), L483 (≠ Y472), M485 (vs. gap), V486 (vs. gap), W489 (vs. gap)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (≠ I281), R292 (≠ T282), W489 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (= R153), G223 (= G210), G224 (= G211), T246 (= T233), L247 (≠ I234), M248 (≠ N235), M263 (≠ L247), L264 (≠ I248), G265 (= G249), M266 (≠ S250), H267 (≠ T251), G286 (= G271), V287 (≠ T272), R288 (≠ E273), D290 (= D280), V293 (≠ F283), D310 (= D297), I311 (= I298), D329 (= D316), V330 (≠ S317), M405 (≠ V387), G423 (≠ T407), G424 (= G408)
- binding magnesium ion: D453 (= D442), N480 (= N469), H482 (≠ G471)
Sites not aligning to the query:
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
30% identity, 97% coverage: 6:534/545 of query aligns to 16:554/582 of 1yi0A
- active site: Y33 (≠ I23), G35 (= G25), G36 (≠ V26), A37 (≠ H27), S38 (≠ T28), E59 (= E48), T82 (≠ I71), F121 (≠ L112), Q122 (≠ H113), E123 (= E114), K171 (≠ L163), M266 (≠ S250), V293 (≠ F283), V400 (≠ D382), G426 (= G410), M428 (≠ L412), D453 (= D442), N480 (= N469), H482 (≠ G471), L483 (≠ Y472), M485 (vs. gap), V486 (vs. gap), W489 (vs. gap)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (≠ I281), R292 (≠ T282), W489 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G209), G223 (= G210), G224 (= G211), T246 (= T233), L247 (≠ I234), M248 (≠ N235), L264 (≠ I248), G265 (= G249), M266 (≠ S250), H267 (≠ T251), G286 (= G271), V287 (≠ T272), R288 (≠ E273), D290 (= D280), R292 (≠ T282), V293 (≠ F283), D310 (= D297), I311 (= I298), G328 (≠ A315), D329 (= D316), V330 (≠ S317), M405 (≠ V387), G423 (≠ T407), G424 (= G408)
- binding magnesium ion: D453 (= D442), N480 (= N469), H482 (≠ G471)
Sites not aligning to the query:
1yhzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
30% identity, 97% coverage: 6:534/545 of query aligns to 16:554/582 of 1yhzA
- active site: Y33 (≠ I23), G35 (= G25), G36 (≠ V26), A37 (≠ H27), S38 (≠ T28), E59 (= E48), T82 (≠ I71), F121 (≠ L112), Q122 (≠ H113), E123 (= E114), K171 (≠ L163), M266 (≠ S250), V293 (≠ F283), V400 (≠ D382), G426 (= G410), M428 (≠ L412), D453 (= D442), N480 (= N469), H482 (≠ G471), L483 (≠ Y472), M485 (vs. gap), V486 (vs. gap), W489 (vs. gap)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: D291 (≠ I281), R292 (≠ T282), M485 (vs. gap), W489 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (= R153), G223 (= G210), G224 (= G211), T246 (= T233), L247 (≠ I234), M248 (≠ N235), L264 (≠ I248), M266 (≠ S250), H267 (≠ T251), G286 (= G271), V287 (≠ T272), R288 (≠ E273), D290 (= D280), V293 (≠ F283), D310 (= D297), I311 (= I298), D329 (= D316), V330 (≠ S317), Q404 (≠ P386), M405 (≠ V387), G423 (≠ T407), G424 (= G408)
- binding magnesium ion: D453 (= D442), N480 (= N469), H482 (≠ G471)
Sites not aligning to the query:
1yhyA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
30% identity, 97% coverage: 6:534/545 of query aligns to 16:554/582 of 1yhyA
- active site: Y33 (≠ I23), G35 (= G25), G36 (≠ V26), A37 (≠ H27), S38 (≠ T28), E59 (= E48), T82 (≠ I71), F121 (≠ L112), Q122 (≠ H113), E123 (= E114), K171 (≠ L163), M266 (≠ S250), V293 (≠ F283), V400 (≠ D382), G426 (= G410), M428 (≠ L412), D453 (= D442), N480 (= N469), H482 (≠ G471), L483 (≠ Y472), M485 (vs. gap), V486 (vs. gap), W489 (vs. gap)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (≠ I281), R292 (≠ T282), V486 (vs. gap), W489 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G209), G223 (= G210), G224 (= G211), T246 (= T233), L247 (≠ I234), M248 (≠ N235), L264 (≠ I248), G265 (= G249), M266 (≠ S250), H267 (≠ T251), G286 (= G271), V287 (≠ T272), R288 (≠ E273), D290 (= D280), V293 (≠ F283), D310 (= D297), I311 (= I298), D329 (= D316), V330 (≠ S317), Q404 (≠ P386), M405 (≠ V387), G423 (≠ T407), G424 (= G408)
- binding magnesium ion: D453 (= D442), N480 (= N469), H482 (≠ G471)
Sites not aligning to the query:
1ybhA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide chlorimuron ethyl (see paper)
30% identity, 97% coverage: 6:534/545 of query aligns to 16:554/582 of 1ybhA
- active site: Y33 (≠ I23), G35 (= G25), G36 (≠ V26), A37 (≠ H27), S38 (≠ T28), E59 (= E48), T82 (≠ I71), F121 (≠ L112), Q122 (≠ H113), E123 (= E114), K171 (≠ L163), M266 (≠ S250), V293 (≠ F283), V400 (≠ D382), G426 (= G410), M428 (≠ L412), D453 (= D442), N480 (= N469), H482 (≠ G471), L483 (≠ Y472), M485 (vs. gap), V486 (vs. gap), W489 (vs. gap)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: M266 (≠ S250), D291 (≠ I281), R292 (≠ T282), M485 (vs. gap), W489 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (= R153), G223 (= G210), G224 (= G211), T246 (= T233), L247 (≠ I234), M248 (≠ N235), L264 (≠ I248), M266 (≠ S250), H267 (≠ T251), G286 (= G271), V287 (≠ T272), R288 (≠ E273), D290 (= D280), V293 (≠ F283), D310 (= D297), I311 (= I298), D329 (= D316), V330 (≠ S317), Q404 (≠ P386), M405 (≠ V387), G423 (≠ T407), G424 (= G408)
- binding magnesium ion: D453 (= D442), N480 (= N469), H482 (≠ G471)
Sites not aligning to the query:
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
30% identity, 97% coverage: 6:534/545 of query aligns to 16:554/585 of 5k2oA
- active site: Y33 (≠ I23), G35 (= G25), G36 (≠ V26), A37 (≠ H27), S38 (≠ T28), E59 (= E48), T82 (≠ I71), F121 (≠ L112), Q122 (≠ H113), E123 (= E114), K171 (≠ L163), M266 (≠ S250), V293 (≠ F283), V400 (≠ D382), G426 (= G410), M428 (≠ L412), D453 (= D442), N480 (= N469), H482 (≠ G471), L483 (≠ Y472), M485 (vs. gap), V486 (vs. gap), W489 (vs. gap)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (≠ S250), R292 (≠ T282), W489 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G209), G223 (= G210), G224 (= G211), T246 (= T233), L247 (≠ I234), M248 (≠ N235), L264 (≠ I248), G286 (= G271), R288 (≠ E273), D290 (= D280), V293 (≠ F283), D310 (= D297), I311 (= I298), D329 (= D316), V330 (≠ S317), Q404 (≠ P386), M405 (≠ V387), G423 (≠ T407)
- binding magnesium ion: D453 (= D442), N480 (= N469), H482 (≠ G471)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ D382), G401 (≠ S383), Q402 (≠ T384), H403 (≠ Q385), M428 (≠ L412), D453 (= D442), G454 (= G443), S455 (≠ G444), N480 (= N469), H482 (≠ G471), L483 (≠ Y472), G484 (≠ E473), M485 (vs. gap), V486 (vs. gap)
Sites not aligning to the query:
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
30% identity, 97% coverage: 6:534/545 of query aligns to 16:554/583 of 5k3sA
- active site: Y33 (≠ I23), G35 (= G25), G36 (≠ V26), A37 (≠ H27), S38 (≠ T28), E59 (= E48), T82 (≠ I71), F121 (≠ L112), Q122 (≠ H113), E123 (= E114), K171 (≠ L163), M266 (≠ S250), V293 (≠ F283), V400 (≠ D382), G426 (= G410), M428 (≠ L412), D453 (= D442), N480 (= N469), H482 (≠ G471), L483 (≠ Y472), M485 (vs. gap), V486 (vs. gap), W489 (vs. gap)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (≠ T282), M485 (vs. gap), W489 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G209), G223 (= G210), G224 (= G211), T246 (= T233), L247 (≠ I234), M248 (≠ N235), L264 (≠ I248), M266 (≠ S250), G286 (= G271), R288 (≠ E273), D290 (= D280), V293 (≠ F283), D310 (= D297), I311 (= I298), D329 (= D316), V330 (≠ S317), M405 (≠ V387), G423 (≠ T407)
- binding magnesium ion: D453 (= D442), N480 (= N469), H482 (≠ G471)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ D382), G401 (≠ S383), Q402 (≠ T384), H403 (≠ Q385), G426 (= G410), M428 (≠ L412), D453 (= D442), G454 (= G443), S455 (≠ G444), N480 (= N469), H482 (≠ G471), L483 (≠ Y472), G484 (≠ E473), M485 (vs. gap), V486 (vs. gap)
Sites not aligning to the query:
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
30% identity, 97% coverage: 6:534/545 of query aligns to 101:639/670 of P17597
- A122 (≠ H27) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ V29) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E48) binding
- S186 (= S90) binding
- P197 (≠ S101) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ S103) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (≠ H113) binding
- K220 (≠ A127) binding
- R246 (= R153) binding ; binding
- K256 (≠ L163) binding
- G308 (= G210) binding
- TL 331:332 (≠ TI 233:234) binding
- C340 (≠ S242) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (≠ IGST 248:251) binding
- GVR-----FD 371:375 (≠ GTELAETDYD 271:280) binding
- DR 376:377 (≠ IT 281:282) binding
- DI 395:396 (= DI 297:298) binding
- DV 414:415 (≠ DS 316:317) binding
- QH 487:488 (≠ TQ 384:385) binding
- GG 508:509 (≠ TG 407:408) binding
- GAM 511:513 (≠ GTL 410:412) binding
- D538 (= D442) binding
- DGS 538:540 (≠ DGG 442:444) binding
- N565 (= N469) binding
- NQHLGM 565:570 (≠ NQGYE- 469:473) binding
- H567 (≠ G471) binding
- W574 (vs. gap) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
Sites not aligning to the query:
- 653 binding ; S→A: No effect on catalytic activity or sensitivity to herbicides.; S→F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; S→N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; S→T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
30% identity, 97% coverage: 6:534/545 of query aligns to 98:636/667 of P09342
- C161 (= C68) modified: Disulfide link with 307
- P194 (≠ S101) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ A212) modified: Disulfide link with 161
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
31% identity, 97% coverage: 6:534/545 of query aligns to 95:633/664 of P09114
- P191 (≠ S101) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (vs. gap) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
6vz8D Arabidopsis thaliana acetohydroxyacid synthase complex with valine bound (see paper)
31% identity, 97% coverage: 6:534/545 of query aligns to 15:527/531 of 6vz8D
- active site: Y32 (≠ I23), G34 (= G25), G35 (≠ V26), A36 (≠ H27), S37 (≠ T28), E58 (= E48), T81 (≠ I71), F120 (≠ L112), Q121 (≠ H113), E122 (= E114), K170 (≠ L163), M256 (≠ S250), V283 (≠ F283), V376 (≠ D382), G402 (= G410), M404 (≠ L412), D429 (= D442), N456 (= N469), H458 (≠ G471), L459 (≠ Y472), M461 (vs. gap), V462 (vs. gap), W465 (vs. gap)
- binding flavin-adenine dinucleotide: G214 (= G209), G215 (= G210), G216 (= G211), T236 (= T233), L237 (≠ I234), L254 (≠ I248), H257 (≠ T251), R278 (≠ E273), R282 (≠ T282), V283 (≠ F283), I291 (= I298), G399 (≠ T407)
- binding magnesium ion: H458 (≠ G471), L459 (≠ Y472), G460 (≠ E473)
- binding thiamine diphosphate: E58 (= E48), P84 (= P74), V376 (≠ D382), G377 (≠ S383), Q378 (≠ T384), H379 (≠ Q385), G402 (= G410), M404 (≠ L412), G428 (= G441), D429 (= D442), G430 (= G443), S431 (≠ G444), L459 (≠ Y472), G460 (≠ E473), M461 (vs. gap), V462 (vs. gap)
Query Sequence
>Pf1N1B4_696 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_696
MATCGEVLVKLLEDYGVEQVFGIPGVHTVELYRGLARSSINHVTPRHEQGAGFMADGYAR
TSGKPGVCFIITGPGMTNITTAMGQAYADSIPMLVISSVQSRSQLGGGRGKLHELPNQSA
LVGGVAAFSHTLMSAAELPGVLARAFALFQAGRPRPVHIEIPLDVLVEEADDLLASVPVN
IDRAGASPSAISRMTDWLAGAKRPLILAGGGAIDAAAELTELAELLDAPVALTINAKGML
ESRHPLLIGSTQSLVATRALVAEADVVLAIGTELAETDYDITFAGGFEIPGVLLRVDIDP
DQTVRNYPPKVALVADSRNAAQALLSALSHKSLAERRNDWGQVRAAHLRDELAASWDAPT
LAQTRFLETVLHELPNAVFVGDSTQPVYTGNLTFNPERPRRWFNSSTGYGTLGYALPAAI
GAWLGGRVEGGARPPVVCLIGDGGLQFTLPELASAVEARTPVIVLLWNNQGYEEIKKYMV
NRAIEPVGVDIYTPDFIGVAKALGCAAEAVSSVDGLRDALRLATDRQGPTLIEIDQTQWM
KAVSQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory