Comparing Pf1N1B4_774 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_774 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
58% identity, 99% coverage: 1:242/244 of query aligns to 2:240/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
58% identity, 99% coverage: 1:242/244 of query aligns to 1:240/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
55% identity, 99% coverage: 1:242/244 of query aligns to 3:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
55% identity, 99% coverage: 1:242/244 of query aligns to 3:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
55% identity, 99% coverage: 1:242/244 of query aligns to 3:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
55% identity, 99% coverage: 1:242/244 of query aligns to 3:242/242 of 2oljA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
49% identity, 99% coverage: 2:243/244 of query aligns to 7:258/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
49% identity, 99% coverage: 2:243/244 of query aligns to 3:254/258 of 1b0uA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 100% coverage: 1:243/244 of query aligns to 1:246/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
37% identity, 100% coverage: 1:243/244 of query aligns to 2:247/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
37% identity, 100% coverage: 1:243/244 of query aligns to 2:247/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
37% identity, 100% coverage: 1:243/244 of query aligns to 2:247/344 of 3tuiC
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
36% identity, 90% coverage: 1:220/244 of query aligns to 2:223/227 of 8igqA
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
36% identity, 90% coverage: 1:220/244 of query aligns to 1:222/229 of A5U7B7
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
36% identity, 90% coverage: 1:220/244 of query aligns to 2:223/225 of 8iddA
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
36% identity, 91% coverage: 2:224/244 of query aligns to 4:222/369 of P19566
Sites not aligning to the query:
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
33% identity, 93% coverage: 1:226/244 of query aligns to 3:229/229 of 6z67B
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
33% identity, 93% coverage: 1:226/244 of query aligns to 3:229/230 of 6z4wA
A0A0H2ZM82 Cell division ATP-binding protein FtsE from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
33% identity, 93% coverage: 1:226/244 of query aligns to 3:229/230 of A0A0H2ZM82
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
39% identity, 88% coverage: 1:214/244 of query aligns to 1:223/232 of 1f3oA
>Pf1N1B4_774 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_774
MISIKNVNKWYGDFQVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKGDVIV
DGTSIADPKTNLPKLRSRVGMVFQHFELFPHLSIMDNLTIAQVKVLGRSKEEASKKALQL
LERVGLSAHAKKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVNEVLDVMV
QLAHEGMTMMCVTHEMGFARKVADRVIFMDQGKIIEDCKKEEFFGDITARSDRAQHFLEK
ILQH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory