Comparing Pf1N1B4_833 PTS system, glucose-specific IIA component / Phosphotransferase system, phosphocarrier protein HPr / Phosphoenolpyruvate-protein phosphotransferase of PTS system (EC 2.7.3.9) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P08839 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Escherichia coli (strain K12) (see 2 papers)
41% identity, 64% coverage: 276:816/844 of query aligns to 1:553/575 of P08839
2hwgA Structure of phosphorylated enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system (see paper)
41% identity, 64% coverage: 277:816/844 of query aligns to 1:552/572 of 2hwgA
P23533 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Staphylococcus carnosus (strain TM300) (see paper)
38% identity, 66% coverage: 277:831/844 of query aligns to 5:569/573 of P23533
2wqdA Crystal structure of enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system in the dephosphorylated state (see paper)
37% identity, 66% coverage: 276:831/844 of query aligns to 3:569/570 of 2wqdA
2xz9A Crystal structure from the phosphoenolpyruvate-binding domain of enzyme i in complex with pyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
44% identity, 36% coverage: 526:829/844 of query aligns to 4:311/317 of 2xz9A
2xz7A Crystal structure of the phosphoenolpyruvate-binding domain of enzyme i in complex with phosphoenolpyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
44% identity, 36% coverage: 526:829/844 of query aligns to 11:318/324 of 2xz7A
P69783 PTS system glucose-specific EIIA component; EIIA-Glc; EIII-Glc; Glucose-specific phosphotransferase enzyme IIA component from Escherichia coli (strain K12) (see 6 papers)
40% identity, 17% coverage: 7:147/844 of query aligns to 21:161/169 of P69783
Sites not aligning to the query:
1o2fA Complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
40% identity, 17% coverage: 7:147/844 of query aligns to 2:142/150 of 1o2fA
1glcF Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
40% identity, 17% coverage: 7:147/844 of query aligns to 13:153/161 of 1glcF
5lu4A C4-type pyruvate phosphate dikinase: conformational intermediate of central domain in the swiveling mechanism (see paper)
27% identity, 45% coverage: 423:803/844 of query aligns to 425:850/850 of 5lu4A
Sites not aligning to the query:
P09323 PTS system N-acetylglucosamine-specific EIICBA component; EIICBA-Nag; EII-Nag; EC 2.7.1.193 from Escherichia coli (strain K12) (see paper)
41% identity, 14% coverage: 8:123/844 of query aligns to 500:615/648 of P09323
Sites not aligning to the query:
Q02KR1 Phosphoenolpyruvate synthase; PEP synthase; Pyruvate, water dikinase; EC 2.7.9.2 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see paper)
29% identity, 47% coverage: 374:766/844 of query aligns to 340:749/791 of Q02KR1
5jvjB C4-type pyruvate phosphate dikinase: different conformational states of the nucleotide binding domain in the dimer (see paper)
26% identity, 45% coverage: 423:803/844 of query aligns to 352:795/797 of 5jvjB
Sites not aligning to the query:
5jvlA C4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue (see paper)
26% identity, 45% coverage: 423:803/844 of query aligns to 425:872/874 of 5jvlA
Sites not aligning to the query:
Q39735 Pyruvate, phosphate dikinase, chloroplastic; Cold-sensitive pyruvate, orthophosphate dikinase; Pyruvate, orthophosphate dikinase; EC 2.7.9.1 from Flaveria bidentis (Coastal plain yellowtops) (Ethulia bidentis) (see 2 papers)
26% identity, 45% coverage: 423:803/844 of query aligns to 504:951/953 of Q39735
Sites not aligning to the query:
1vbgA Pyruvate phosphate dikinase from maize (see paper)
28% identity, 45% coverage: 423:803/844 of query aligns to 425:872/874 of 1vbgA
Sites not aligning to the query:
P11155 Pyruvate, phosphate dikinase 1, chloroplastic; Pyruvate, orthophosphate dikinase 1; EC 2.7.9.1 from Zea mays (Maize) (see 7 papers)
27% identity, 45% coverage: 423:803/844 of query aligns to 498:945/947 of P11155
Sites not aligning to the query:
P37349 PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM; Dihydroxyacetone kinase subunit M; EC 2.7.1.121 from Escherichia coli (strain K12) (see paper)
30% identity, 35% coverage: 175:470/844 of query aligns to 160:444/472 of P37349
Sites not aligning to the query:
O23404 Pyruvate, phosphate dikinase 1, chloroplastic; Pyruvate, orthophosphate dikinase 1; EC 2.7.9.1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 45% coverage: 424:803/844 of query aligns to 515:960/963 of O23404
1kc7A Pyruvate phosphate dikinase with bound mg-phosphonopyruvate (see paper)
26% identity, 45% coverage: 416:794/844 of query aligns to 416:859/872 of 1kc7A
Sites not aligning to the query:
>Pf1N1B4_833 PTS system, glucose-specific IIA component / Phosphotransferase system, phosphocarrier protein HPr / Phosphoenolpyruvate-protein phosphotransferase of PTS system (EC 2.7.3.9)
MATPQQLQLLAPLSGVLMPLDQVPDQVFSSRVIGDGLCIDPTSQTLCAPLTGVISNVQVS
GHAVSITDDNGVQVLMHIGLDTVNLAGKGFTRLVEEGQRVIVGQALIEFDADYIALHARS
LLTLMLVVSGEPFTWLAPETGVVESGQPLLSLNPSEGAADEGIAQEGEALFSKPVTLPNT
NGLHARPAAVFAQAAKGFAASICLHKQQDSANAKSLVAIMALQTAHGDVLQVSAAGADAE
VAIKTLAELLAAGCGEAVTLMAEVETVAAQVSSLTVLRGVCASPGAAFGQVVQIAEQTLE
VSESGVSPQVEREHLSRALAKAVLALQQLRDKATGDAQADIFKAHQELLEDPGLLDQALA
LIDAGKSAGFAWRAATESTATLFKKLGNALLAERAADLADVGQRVLKLILGVEDRAMELP
DGAILIAEQLTPSQTAGLDTRKVLGFATVGGGATSHVAILARASGLPAICGLPVQVLTLI
NGTRVLLDADKGELQLDPELAAIEQLQANRQLQKQRQQYELANAGLAARTRDGHHVEITA
NIASLAEAEQAMALGGDGVGLLRSEFLYLDRNHAPSHDEQASTYGAIARALGPARNLVVR
TLDVGGDKPLAYVPMDRETNPFLGMRGIRLCLERPQLLRDQFKAILSSAGLARLHIMLPM
VTQLSELRLARQLLEEEALALGLTELPKLGIMIEVPAAALMADLFAPEVDFFSIGTNDLT
QYTLAMDRDHPRLASQADSFHPSVLRLIATTVKAAHAHGKWVGVCGALASEKLAVPLLLG
LGVDELSVSVPLIPAIKAAVREVDLLDCQAIAQQVLGLESAEQVREALRRHHEATVDTSL
VLEN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory