SitesBLAST
Comparing Pf6N2E2_1002 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1002 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
30% identity, 99% coverage: 2:330/333 of query aligns to 3:338/340 of 4n54A
- active site: K96 (= K93), H183 (= H174)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: R12 (= R11), K96 (= K93), D156 (= D152), D179 (= D170), M180 (= M171), H183 (= H174), R238 (= R229), Y244 (≠ F235)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V8 (≠ L7), G9 (= G8), L10 (≠ A9), G11 (= G10), R12 (= R11), L13 (≠ I12), S35 (≠ D33), V36 (≠ P34), E40 (≠ G38), S73 (≠ T70), P74 (= P71), F77 (= F74), H78 (= H75), E95 (= E92), K96 (= K93), M125 (≠ N121), F167 (vs. gap), F284 (= F276)
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
30% identity, 99% coverage: 2:330/333 of query aligns to 5:340/342 of 3ceaA
- active site: K98 (= K93), H185 (= H174)
- binding nicotinamide-adenine-dinucleotide: G11 (= G8), G13 (= G10), R14 (= R11), L15 (≠ I12), L38 (≠ P34), Q42 (≠ G38), V74 (≠ G69), A75 (≠ T70), P76 (= P71), T77 (= T72), F79 (= F74), H80 (= H75), M83 (≠ L78), E97 (= E92), K98 (= K93), M127 (≠ N121), F169 (vs. gap), H185 (= H174), F286 (= F276)
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
29% identity, 97% coverage: 2:325/333 of query aligns to 3:321/336 of 3ec7A
- active site: K97 (= K93), H176 (= H174)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), M12 (≠ R11), I13 (= I12), D35 (= D33), I36 (≠ P34), R40 (≠ G38), T73 (≠ G69), A74 (≠ T70), S75 (≠ P71), N76 (≠ T72), H79 (= H75), E96 (= E92), K97 (= K93), M126 (≠ N121), W271 (≠ F276), Y279 (= Y284)
3nt5A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor and product inosose (see paper)
26% identity, 99% coverage: 2:330/333 of query aligns to 3:327/337 of 3nt5A
- active site: K97 (= K93), H176 (= H174)
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K97 (= K93), H155 (≠ S150), H176 (= H174), Y235 (≠ F235)
- binding nicotinamide-adenine-dinucleotide: G9 (= G8), G11 (= G10), A12 (≠ R11), I13 (= I12), D35 (= D33), V36 (≠ P34), S74 (≠ T70), W75 (≠ P71), G76 (≠ T72), E96 (= E92), K97 (= K93), Y280 (= Y284)
3nt4A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadh and inositol (see paper)
26% identity, 99% coverage: 2:330/333 of query aligns to 3:327/337 of 3nt4A
- active site: K97 (= K93), H176 (= H174)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: H155 (≠ S150), H176 (= H174), Y235 (≠ F235), W272 (≠ F276)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G10), A12 (≠ R11), I13 (= I12), D35 (= D33), V36 (≠ P34), S74 (≠ T70), W75 (≠ P71), G76 (≠ T72), E96 (= E92), K97 (= K93), H176 (= H174)
3nt2B Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
26% identity, 99% coverage: 2:330/333 of query aligns to 3:327/337 of 3nt2B
- active site: K97 (= K93), H176 (= H174)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G8), G11 (= G10), A12 (≠ R11), D35 (= D33), V36 (≠ P34), S74 (≠ T70), W75 (≠ P71), A78 (≠ F74), K97 (= K93), W272 (≠ F276), Y280 (= Y284)
3nt2A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
26% identity, 99% coverage: 2:330/333 of query aligns to 3:327/337 of 3nt2A
- active site: K97 (= K93), H176 (= H174)
- binding nicotinamide-adenine-dinucleotide: G9 (= G8), G11 (= G10), A12 (≠ R11), I13 (= I12), D35 (= D33), V36 (≠ P34), S74 (≠ T70), W75 (≠ P71), G76 (≠ T72), A78 (≠ F74), H79 (= H75), E96 (= E92), K97 (= K93), H176 (= H174), Y280 (= Y284)
4l8vA Crystal structure of a12k/d35s mutant myo-inositol dehydrogenase from bacillus subtilis with bound cofactor NADP (see paper)
26% identity, 99% coverage: 2:330/333 of query aligns to 3:327/337 of 4l8vA
- active site: K97 (= K93), H176 (= H174)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ R11), I13 (= I12), S74 (≠ T70), W75 (≠ P71), H79 (= H75), E96 (= E92), K97 (= K93), M126 (≠ N121), W272 (≠ F276), Y280 (= Y284)
8qc8D Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ (see paper)
26% identity, 99% coverage: 2:330/333 of query aligns to 2:338/339 of 8qc8D
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), H11 (≠ R11), M12 (≠ I12), D33 (= D33), P34 (= P34), T35 (≠ W35), S38 (≠ G38), A71 (≠ G69), S72 (≠ T70), P73 (= P71), N74 (≠ T72), H77 (= H75), E96 (= E92), K97 (= K93), E125 (≠ N121), K162 (vs. gap), V163 (vs. gap), W166 (≠ A157)
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
27% identity, 83% coverage: 52:328/333 of query aligns to 85:369/381 of 1rydA
- active site: K129 (= K93), Y217 (≠ H174)
- binding alpha-D-glucopyranose: Y236 (≠ V193), I254 (≠ M212), Q256 (≠ L214)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y87 (= Y54), L106 (≠ T70), P107 (= P71), N108 (≠ T72), L110 (≠ F74), H111 (= H75), E128 (= E92), K129 (= K93), R157 (≠ N121), A196 (= A154), W199 (≠ A157), R200 (= R158), Y217 (≠ H174), Y296 (= Y261)
Sites not aligning to the query:
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
27% identity, 83% coverage: 52:328/333 of query aligns to 87:371/383 of 1h6dA
- active site: K131 (= K93), Y219 (≠ H174)
- binding glycerol: K131 (= K93), R202 (= R158), D215 (= D170), Y219 (≠ H174)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y89 (= Y54), I107 (≠ G69), L108 (≠ T70), P109 (= P71), N110 (≠ T72), H113 (= H75), E130 (= E92), K131 (= K93), R159 (≠ N121), A198 (= A154), W201 (≠ A157), R202 (= R158), Y219 (≠ H174), Y298 (= Y261)
Sites not aligning to the query:
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 17, 18, 19, 40, 41, 42, 43, 44, 66, 67, 71
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
26% identity, 91% coverage: 26:328/333 of query aligns to 28:328/340 of 1evjA
- active site: K100 (= K93), Y188 (≠ H174)
- binding nicotinamide-adenine-dinucleotide: D35 (= D33), L77 (≠ T70), P78 (= P71), N79 (≠ T72), H82 (= H75), E99 (= E92), K100 (= K93), R128 (≠ N121), W170 (≠ A157), R171 (= R158), Y188 (≠ H174), Y267 (= Y261)
Sites not aligning to the query:
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
30% identity, 81% coverage: 62:330/333 of query aligns to 62:328/332 of 2glxA
- active site: K93 (= K93), H179 (= H174)
- binding acetate ion: K93 (= K93), H179 (= H174)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S69 (≠ G69), T70 (= T70), N72 (≠ T72), H75 (= H75), E92 (= E92), K93 (= K93), H121 (vs. gap), W161 (≠ A159), R162 (≠ Y160), Y282 (= Y284)
Sites not aligning to the query:
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
28% identity, 99% coverage: 2:330/333 of query aligns to 2:336/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (≠ R11), M12 (≠ I12), D33 (= D33), L34 (≠ P34), T70 (≠ G69), T71 (= T70), P72 (= P71), N73 (≠ T72), L75 (≠ F74), H76 (= H75), Q79 (≠ L78), E93 (= E92), K94 (= K93), N122 (≠ R123), W161 (≠ A156), H179 (= H174), Y290 (= Y284)
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
28% identity, 99% coverage: 2:330/333 of query aligns to 2:336/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (≠ R11), F152 (≠ I147), N154 (≠ T149), D175 (= D170), L176 (≠ M171), H179 (= H174), E236 (≠ F235), W271 (≠ A269)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G10), F11 (≠ R11), M12 (≠ I12), D33 (= D33), L34 (≠ P34), T70 (≠ G69), T71 (= T70), P72 (= P71), N73 (≠ T72), L75 (≠ F74), H76 (= H75), Q79 (≠ L78), E93 (= E92), K94 (= K93), N122 (≠ R123), W161 (≠ A156), H179 (= H174), Y290 (= Y284)
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
28% identity, 99% coverage: 2:330/333 of query aligns to 2:336/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: F11 (≠ R11), N154 (≠ T149), D175 (= D170), H179 (= H174), E236 (≠ F235), W271 (≠ A269)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G8), G10 (= G10), F11 (≠ R11), M12 (≠ I12), D33 (= D33), L34 (≠ P34), T70 (≠ G69), T71 (= T70), P72 (= P71), N73 (≠ T72), L75 (≠ F74), H76 (= H75), Q79 (≠ L78), E93 (= E92), K94 (= K93), N122 (≠ R123), W161 (≠ A156), Y290 (= Y284)
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
24% identity, 99% coverage: 2:330/333 of query aligns to 4:336/336 of 5a06A
- active site: K101 (= K93), Y186 (≠ H174)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L11 (≠ A9), G12 (= G10), Y13 (≠ R11), Y14 (≠ I12), S36 (≠ D33), G37 (≠ P34), T38 (≠ W35), K41 (≠ G38), Y59 (≠ S56), I77 (≠ G69), T78 (= T70), P79 (= P71), N80 (≠ T72), L82 (≠ F74), H83 (= H75), E100 (= E92), K101 (= K93), R129 (≠ N121), W168 (≠ A156), R169 (≠ A157), Y186 (≠ H174), Y264 (≠ V258)
- binding sorbitol: D72 (= D64), H96 (≠ P88), K101 (= K93), R122 (≠ G114), R122 (≠ G114), L124 (≠ V116), F160 (≠ I148), R169 (≠ A157), D182 (= D170), Y186 (≠ H174), K287 (≠ A281), H296 (≠ S290), E299 (≠ D293), E306 (≠ P300), G310 (≠ T304), G311 (≠ P305)
Sites not aligning to the query:
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
24% identity, 99% coverage: 2:330/333 of query aligns to 4:336/336 of 5a03C
- active site: K101 (= K93), Y186 (≠ H174)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G10 (= G8), L11 (≠ A9), G12 (= G10), Y13 (≠ R11), Y14 (≠ I12), S36 (≠ D33), G37 (≠ P34), T38 (≠ W35), K41 (≠ G38), Y59 (≠ S56), I77 (≠ G69), T78 (= T70), P79 (= P71), N80 (≠ T72), L82 (≠ F74), H83 (= H75), E100 (= E92), K101 (= K93), R129 (≠ N121), W168 (≠ A156), R169 (≠ A157), Y186 (≠ H174), Y264 (≠ V258)
- binding beta-D-xylopyranose: K101 (= K93), F160 (≠ I148), R169 (≠ A157), D182 (= D170), Y186 (≠ H174)
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
24% identity, 99% coverage: 2:330/333 of query aligns to 3:335/335 of 5a05A
- active site: K100 (= K93), Y185 (≠ H174)
- binding beta-D-glucopyranose: K100 (= K93), F159 (≠ I148), D181 (= D170), Y185 (≠ H174)
- binding alpha-D-glucopyranose: P259 (≠ R254), S262 (= S257)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G8), L10 (≠ A9), G11 (= G10), Y12 (≠ R11), Y13 (≠ I12), S35 (≠ D33), G36 (≠ P34), T37 (≠ W35), K40 (≠ G38), Y58 (≠ S56), I76 (≠ G69), T77 (= T70), P78 (= P71), N79 (≠ T72), L81 (≠ F74), H82 (= H75), E99 (= E92), K100 (= K93), R128 (≠ N121), W167 (≠ A156), R168 (≠ A157), Y185 (≠ H174), Y263 (≠ V258)
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
24% identity, 99% coverage: 2:330/333 of query aligns to 3:335/335 of 5a04A
- active site: K100 (= K93), Y185 (≠ H174)
- binding beta-D-glucopyranose: K100 (= K93), F159 (≠ I148), R168 (≠ A157), D181 (= D170), Y185 (≠ H174)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L10 (≠ A9), G11 (= G10), Y12 (≠ R11), Y13 (≠ I12), S35 (≠ D33), G36 (≠ P34), T37 (≠ W35), K40 (≠ G38), Y58 (≠ S56), I76 (≠ G69), T77 (= T70), P78 (= P71), N79 (≠ T72), L81 (≠ F74), H82 (= H75), E99 (= E92), K100 (= K93), R128 (≠ N121), W167 (≠ A156), R168 (≠ A157), Y185 (≠ H174), Y263 (≠ V258)
Query Sequence
>Pf6N2E2_1002 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1002
MLRIAVLGAGRIGKIHAANVATNPRTKLVVIADPWKEGVNALAMQLGCEAAYDYASAIER
TDVDAVFIGTPTEFHIELMLQAVRLGKPVICEKPIDMDYERAKAAVDELERLNGRVMLAF
NRRFDPDYLRLRRAIDDGEIGVVRQVIITSRDPALAARAYLETSGGIFRDMTIHDFDMAR
SLLGEEPVEVFAVGSRLVDPTLESIPDYDSVMVLMRTASGRQCHINCCREAVYGFDQRLE
VSGSKGMLLNENHRTNSVRRYGAEATDVADPLLNFFLERHADSYKIELNSFLDAVENNSP
MPATPRDGLRALRLANCASESAETGKVVRVGDH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory