Comparing Pf6N2E2_1005 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1005 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4irxA Crystal structure of caulobacter myo-inositol binding protein bound to myo-inositol (see paper)
47% identity, 89% coverage: 31:312/317 of query aligns to 10:292/296 of 4irxA
4rxmA Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
39% identity, 91% coverage: 30:316/317 of query aligns to 5:290/291 of 4rxmA
Sites not aligning to the query:
4rxmB Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
39% identity, 91% coverage: 30:316/317 of query aligns to 3:288/288 of 4rxmB
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
35% identity, 85% coverage: 38:307/317 of query aligns to 9:273/274 of 2ioyA
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
31% identity, 90% coverage: 31:314/317 of query aligns to 10:283/284 of 7e7mC
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
34% identity, 81% coverage: 31:287/317 of query aligns to 4:264/287 of 5dteB
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
31% identity, 82% coverage: 30:289/317 of query aligns to 3:255/270 of 4zjpA
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
29% identity, 90% coverage: 28:311/317 of query aligns to 4:284/287 of 4yo7A
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
30% identity, 79% coverage: 38:289/317 of query aligns to 10:255/271 of 1dbpA
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
29% identity, 89% coverage: 31:313/317 of query aligns to 3:289/292 of 2fn8A
5ocpA The periplasmic binding protein component of the arabinose abc transporter from shewanella sp. Ana-3 bound to alpha and beta-l- arabinofuranose
33% identity, 71% coverage: 47:271/317 of query aligns to 18:245/302 of 5ocpA
Sites not aligning to the query:
4ry9B Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
30% identity, 82% coverage: 31:289/317 of query aligns to 4:267/297 of 4ry9B
4ry9A Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
30% identity, 82% coverage: 31:289/317 of query aligns to 4:267/297 of 4ry9A
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
28% identity, 82% coverage: 55:313/317 of query aligns to 26:280/314 of 5hkoA
Sites not aligning to the query:
P39325 Galactofuranose-binding protein YtfQ from Escherichia coli (strain K12) (see 2 papers)
31% identity, 70% coverage: 51:272/317 of query aligns to 45:271/318 of P39325
Sites not aligning to the query:
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
28% identity, 82% coverage: 55:313/317 of query aligns to 26:280/315 of 4rs3A
Sites not aligning to the query:
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
28% identity, 82% coverage: 55:313/317 of query aligns to 59:313/349 of A0QYB3
Sites not aligning to the query:
2vk2A Crystal structure of a galactofuranose binding protein (see paper)
31% identity, 70% coverage: 51:272/317 of query aligns to 23:249/296 of 2vk2A
Sites not aligning to the query:
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
28% identity, 82% coverage: 55:313/317 of query aligns to 59:313/349 of A0QYB5
Sites not aligning to the query:
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
28% identity, 82% coverage: 55:313/317 of query aligns to 27:281/315 of 4rsmA
Sites not aligning to the query:
>Pf6N2E2_1005 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1005
MKAQKGGLLCSAVLAAGLTFQLSPAFAAGEKILINFQTLSIPYFIYMHEQASQEAKVLNV
ELLVQDAQSSSTKQSSDVENALTQGVDAMVVAPNDVTALAPALNEVLSEKVPLVTVDRRV
EGTDTPVPYVTADSVAGGRLMAELVTSNMKNGARVAFIGGTPGSSTAIDRAKGVHEGLKA
GGGKFQLVAEQSGEWERAKAMSVAENILTSLSANPPDAIICASGDMALGAAEAVRATGLK
GKVKVIGFDAYPEVLRAIRDGDIAGIVEQSPSKQIRTALRMAVKKVRGEGELETVIVQPF
MITPENLSQAEQYSAIQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory