Comparing Pf6N2E2_1006 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1006 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4irxA Crystal structure of caulobacter myo-inositol binding protein bound to myo-inositol (see paper)
51% identity, 98% coverage: 1:173/177 of query aligns to 120:293/296 of 4irxA
Sites not aligning to the query:
4rxmA Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
38% identity, 94% coverage: 10:176/177 of query aligns to 124:290/291 of 4rxmA
Sites not aligning to the query:
4rxmB Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
38% identity, 94% coverage: 10:176/177 of query aligns to 122:288/288 of 4rxmB
Sites not aligning to the query:
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
32% identity, 94% coverage: 3:169/177 of query aligns to 121:281/284 of 7e7mC
Sites not aligning to the query:
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
34% identity, 95% coverage: 1:169/177 of query aligns to 113:285/292 of 2fn8A
Sites not aligning to the query:
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
32% identity, 75% coverage: 2:133/177 of query aligns to 113:239/271 of 1dbpA
Sites not aligning to the query:
5ocpA The periplasmic binding protein component of the arabinose abc transporter from shewanella sp. Ana-3 bound to alpha and beta-l- arabinofuranose
33% identity, 74% coverage: 1:131/177 of query aligns to 114:245/302 of 5ocpA
Sites not aligning to the query:
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
33% identity, 80% coverage: 12:152/177 of query aligns to 133:270/288 of 1rpjA
Sites not aligning to the query:
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
33% identity, 80% coverage: 12:152/177 of query aligns to 133:270/288 of 1gudA
Sites not aligning to the query:
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
33% identity, 73% coverage: 2:131/177 of query aligns to 114:237/270 of 4zjpA
Sites not aligning to the query:
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
30% identity, 93% coverage: 3:167/177 of query aligns to 113:273/274 of 2ioyA
Sites not aligning to the query:
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
31% identity, 89% coverage: 3:159/177 of query aligns to 123:276/288 of 8wlbA
Sites not aligning to the query:
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
31% identity, 89% coverage: 3:159/177 of query aligns to 123:276/288 of 8wl9A
Sites not aligning to the query:
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
28% identity, 94% coverage: 5:171/177 of query aligns to 122:284/287 of 4yo7A
Sites not aligning to the query:
2vk2A Crystal structure of a galactofuranose binding protein (see paper)
30% identity, 89% coverage: 1:158/177 of query aligns to 115:274/296 of 2vk2A
Sites not aligning to the query:
P39325 Galactofuranose-binding protein YtfQ from Escherichia coli (strain K12) (see 2 papers)
30% identity, 89% coverage: 1:158/177 of query aligns to 137:296/318 of P39325
Sites not aligning to the query:
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
32% identity, 76% coverage: 14:147/177 of query aligns to 134:264/287 of 5dteB
Sites not aligning to the query:
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
29% identity, 89% coverage: 14:170/177 of query aligns to 125:278/315 of 4rsmA
Sites not aligning to the query:
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
29% identity, 89% coverage: 14:170/177 of query aligns to 157:310/349 of A0QYB5
Sites not aligning to the query:
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
27% identity, 89% coverage: 14:170/177 of query aligns to 124:277/315 of 4rs3A
Sites not aligning to the query:
>Pf6N2E2_1006 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1006
MGDWVVKNLPTGANVVLITGQIGSTTAMDRAKGVHQSLTAAGSKFKLVAEQSGEADRAKA
MSVVENILTASAGNPPDVIICSTGDMTLGAVEAVRGMGLSDKIKIIGYDAYPEVLKSIKA
GEITGIVEQSPSKQIRTALRLAVENIRNGTKIESVTITPFMVTRENLDQAEQFSAIK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory