SitesBLAST
Comparing Pf6N2E2_1079 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1079 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
36% identity, 85% coverage: 23:295/320 of query aligns to 16:289/304 of 1wwkA
- active site: S96 (≠ Y104), R230 (= R236), D254 (= D260), E259 (= E265), H278 (= H284)
- binding nicotinamide-adenine-dinucleotide: V100 (≠ T108), G146 (= G152), F147 (≠ L153), G148 (= G154), R149 (≠ S155), I150 (= I156), Y168 (≠ W174), D169 (≠ S175), P170 (≠ Q176), V201 (≠ L207), P202 (≠ V208), T207 (= T213), T228 (= T234), S229 (= S235), D254 (= D260), H278 (= H284), G280 (= G286)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
30% identity, 85% coverage: 40:311/320 of query aligns to 36:315/334 of 5aovA
- active site: L100 (≠ Y104), R241 (= R236), D265 (= D260), E270 (= E265), H288 (= H284)
- binding glyoxylic acid: M52 (= M56), L53 (≠ R57), L53 (≠ R57), Y74 (≠ G79), A75 (≠ G80), V76 (≠ M81), G77 (≠ R82), R241 (= R236), H288 (= H284)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ M81), T104 (= T108), F158 (≠ L153), G159 (= G154), R160 (≠ S155), I161 (= I156), S180 (= S175), R181 (≠ Q176), A211 (≠ H206), V212 (≠ L207), P213 (≠ V208), T218 (= T213), I239 (≠ T234), A240 (≠ S235), R241 (= R236), H288 (= H284), G290 (= G286)
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
34% identity, 80% coverage: 40:295/320 of query aligns to 33:289/301 of 6rj5A
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
34% identity, 80% coverage: 40:295/320 of query aligns to 34:290/305 of 6plfA
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
34% identity, 80% coverage: 40:295/320 of query aligns to 33:289/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (= L151), G147 (= G152), L148 (= L153), G149 (= G154), R150 (≠ S155), I151 (= I156), G152 (= G157), D170 (≠ S175), H201 (= H206), T202 (≠ L207), P203 (≠ V208)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
34% identity, 80% coverage: 40:295/320 of query aligns to 33:289/302 of 6rihA
7dkmA Phgdh covalently linked to oridonin (see paper)
34% identity, 80% coverage: 40:295/320 of query aligns to 34:290/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ M81), A102 (≠ T108), G148 (= G152), R151 (≠ S155), I152 (= I156), Y170 (≠ W174), D171 (≠ S175), P172 (≠ Q176), I173 (≠ N177), H202 (= H206), T203 (≠ L207), P204 (≠ V208), T209 (= T213), C230 (≠ T234), A231 (≠ S235), R232 (= R236), H279 (= H284), G281 (= G286)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18, 293
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
34% identity, 80% coverage: 40:295/320 of query aligns to 30:286/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G154), I148 (= I156), Y166 (≠ W174), D167 (≠ S175), P168 (≠ Q176), I169 (≠ N177), I170 (≠ L178), H198 (= H206), T199 (≠ L207), L208 (= L216), R228 (= R236)
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
34% identity, 80% coverage: 40:295/320 of query aligns to 33:289/303 of 6plgA
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
34% identity, 80% coverage: 40:295/320 of query aligns to 32:288/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (≠ Y104), A100 (≠ T108), R149 (≠ S155), I150 (= I156), Y168 (≠ W174), D169 (≠ S175), P170 (≠ Q176), I171 (≠ N177), H200 (= H206), T201 (≠ L207), P202 (≠ V208), T207 (= T213), C228 (≠ T234), A229 (≠ S235), R230 (= R236), H277 (= H284), G279 (= G286)
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
34% identity, 80% coverage: 40:295/320 of query aligns to 32:288/297 of 6rj3A
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
34% identity, 80% coverage: 39:295/320 of query aligns to 37:294/533 of O43175
- T78 (≠ M81) binding
- R135 (≠ Q137) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ SI 155:156) binding
- D175 (≠ S175) binding
- T207 (≠ L207) binding
- CAR 234:236 (≠ TSR 234:236) binding
- D260 (= D260) binding
- V261 (= V261) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HVGY 284:287) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
38% identity, 66% coverage: 86:295/320 of query aligns to 69:280/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ S155), Y160 (≠ W174), D161 (≠ S175), P162 (≠ Q176), I164 (≠ L178), L179 (≠ K193), T193 (≠ L207), P194 (≠ V208), S198 (≠ R212), L202 (= L216)
7cvpA The crystal structure of human phgdh from biortus.
39% identity, 58% coverage: 110:295/320 of query aligns to 57:243/254 of 7cvpA
- binding nicotinamide-adenine-dinucleotide: G101 (= G152), G103 (= G154), R104 (≠ S155), I105 (= I156), Y123 (≠ W174), D124 (≠ S175), P125 (≠ Q176), I126 (≠ N177), H155 (= H206), T156 (≠ L207), P157 (≠ V208), T162 (= T213), C183 (≠ T234), A184 (≠ S235), R185 (= R236), H232 (= H284), G234 (= G286)
7va1A Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with gdd-04-35
39% identity, 58% coverage: 110:295/320 of query aligns to 7:193/193 of 7va1A
- binding 4-[(3-ethanoylphenyl)sulfamoyl]-~{N}-[4-(3-fluorophenyl)-1,3-thiazol-2-yl]benzamide: L50 (= L151), G53 (= G154), R57 (≠ T158), Y73 (≠ W174), D74 (≠ S175), P75 (≠ Q176), I76 (≠ N177), I77 (≠ L178), T106 (≠ L207), P107 (≠ V208), L115 (= L216)
5z20F The ternary structure of d-lactate dehydrogenase from pseudomonas aeruginosa with nadh and oxamate (see paper)
35% identity, 83% coverage: 48:312/320 of query aligns to 50:330/336 of 5z20F
- active site: S108 (≠ K105), R241 (= R236), D265 (= D260), E270 (= E265), H302 (= H284)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y107 (= Y104), G160 (= G154), Q161 (≠ S155), I162 (= I156), Y180 (≠ W174), D181 (≠ S175), P182 (≠ Q176), C212 (≠ L207), P213 (≠ V208), T218 (= T213), T239 (= T234), G240 (≠ S235), R241 (= R236), H302 (= H284), A304 (≠ G286)
6rj6A Crystal structure of phgdh in complex with bi-4924 (see paper)
39% identity, 58% coverage: 110:295/320 of query aligns to 8:194/204 of 6rj6A
- binding 2-[4-[(1~{S})-1-[[4,5-bis(chloranyl)-1,6-dimethyl-indol-2-yl]carbonylamino]-2-oxidanyl-ethyl]phenyl]sulfonylethanoic acid: G52 (= G152), R55 (≠ S155), I56 (= I156), Y74 (≠ W174), D75 (≠ S175), P76 (≠ Q176), I77 (≠ N177), I78 (≠ L178), H106 (= H206), T107 (≠ L207), P108 (≠ V208), T113 (= T213)
5ofwA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 3-chloro-4-fluorobenzamide (see paper)
39% identity, 58% coverage: 110:295/320 of query aligns to 9:195/195 of 5ofwA
Sites not aligning to the query:
5ofvA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-fluoro-2-methylbenzoic acid (see paper)
39% identity, 58% coverage: 110:295/320 of query aligns to 9:195/195 of 5ofvA
Sites not aligning to the query:
5ofmA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-amino-1-methyl-1h-indole
39% identity, 58% coverage: 110:295/320 of query aligns to 9:195/195 of 5ofmA
Sites not aligning to the query:
Query Sequence
>Pf6N2E2_1079 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1079
MAVQIAVIDDWQDVARDVVDWSVLDSVGQVTFLHDYPADRDTLAERLQRFEVICVMRERT
LFDEGLLRRLPNLKLLLTGGMRNAALDLKAAAELGIQVCGTDSYKHATPELTWALIMALT
RNLMQEANALRAGLWQQGLGGDLHGKTLAILGLGSIGTRVAQFGQVFGMRVIAWSQNLSA
ERAAEVGVTYVSKQALFEQSDILSIHLVLGERTRGLVDAQALAWMKPEALLVNTSRGPIV
DETALINALQHKRLAGAALDVFAQEPLPAAHPFRTLDNVLATPHVGYVSRQNYQRFYSLM
IEDLLAWAAGQPIRLLTPAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory