SitesBLAST
Comparing Pf6N2E2_1114 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1114 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8a56B Coenzyme a-persulfide reductase (coapr) from enterococcus faecalis (see paper)
33% identity, 35% coverage: 15:315/853 of query aligns to 3:313/539 of 8a56B
- binding flavin-adenine dinucleotide: I6 (≠ G18), G7 (≠ N19), V9 (≠ M21), G11 (= G23), E32 (≠ S45), K33 (≠ E46), C42 (≠ V55), V80 (= V90), S109 (≠ A115), P110 (≠ T116), G111 (= G117), I159 (≠ L163), G278 (= G286), D279 (≠ E287), S295 (≠ G297), L296 (= L298), A297 (≠ V299)
- binding 3'-phosphate-adenosine-5'-diphosphate: T17 (≠ Q29), R18 (≠ L30), R21 (= R33), F70 (≠ L84), R305 (= R307)
Sites not aligning to the query:
6pfzA Structure of a NAD-dependent persulfide reductase from a. Fulgidus (see paper)
29% identity, 39% coverage: 92:420/853 of query aligns to 88:440/541 of 6pfzA
- binding calcium ion: D306 (≠ Q304), T332 (≠ S327), D427 (≠ L407), L428 (≠ I408)
- binding coenzyme a: R313 (= R312), Y430 (≠ P410)
- binding flavin-adenine dinucleotide: A115 (= A115), T116 (= T116), G117 (= G117), L136 (≠ Y136), G286 (= G286), D287 (≠ E287), P303 (= P301), F304 (≠ G302), G305 (≠ Y303)
Sites not aligning to the query:
- active site: 37, 42, 455, 456
- binding coenzyme a: 14, 18, 21, 38, 40, 42, 76, 447, 512, 513, 516
- binding flavin-adenine dinucleotide: 7, 11, 32, 33, 41, 42, 86
Q9HTK9 Rubredoxin-NAD(+) reductase; RdxR; EC 1.18.1.1 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
28% identity, 44% coverage: 8:382/853 of query aligns to 1:366/384 of Q9HTK9
2v3aA Crystal structure of rubredoxin reductase from pseudomonas aeruginosa. (see paper)
29% identity, 43% coverage: 14:382/853 of query aligns to 4:363/381 of 2v3aA
- active site: L11 (≠ M21), K42 (≠ R54), P43 (≠ V55), M290 (≠ Y303)
- binding flavin-adenine dinucleotide: I7 (= I17), G8 (= G18), T9 (≠ N19), G10 (= G20), A12 (≠ V22), T33 (≠ S45), A34 (≠ E46), D35 (≠ E47), K42 (≠ R54), P43 (≠ V55), R79 (≠ P89), V80 (= V90), A105 (= A115), W106 (≠ T116), G107 (= G117), I153 (≠ L163), F157 (≠ A167), D274 (≠ E287), L284 (≠ G297), Y285 (≠ L298), V286 (= V299), K317 (≠ G338)
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
31% identity, 39% coverage: 8:338/853 of query aligns to 1:346/422 of P16640
- A15 (≠ V22) binding
- D37 (≠ E46) binding
- K50 (≠ E59) binding
- V83 (= V90) binding
- R134 (= R137) binding
- D284 (≠ E287) binding
- V302 (= V299) binding
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
31% identity, 39% coverage: 9:338/853 of query aligns to 1:345/422 of 1q1wA
- active site: L13 (≠ M21), L44 (≠ R54), P45 (≠ V55), L305 (≠ Y303)
- binding flavin-adenine dinucleotide: G10 (= G18), G12 (= G20), L13 (≠ M21), A14 (≠ V22), G35 (≠ S45), D36 (≠ E46), L44 (≠ R54), P45 (≠ V55), K49 (≠ E59), V82 (= V90), A108 (= A115), T109 (= T116), G110 (= G117), R133 (= R137), I159 (≠ L163), D283 (≠ E287), S300 (vs. gap), V301 (= V299), W329 (≠ T322)
Q8U1K9 NAD(P)H:rubredoxin oxidoreductase; NROR; Rubredoxin--NAD(P)(+) reductase; EC 1.18.1.4 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
29% identity, 43% coverage: 14:383/853 of query aligns to 3:343/359 of Q8U1K9
1xhcA Nadh oxidase /nitrite reductase from pyrococcus furiosus pfu-1140779- 001
30% identity, 39% coverage: 14:345/853 of query aligns to 3:317/346 of 1xhcA
- active site: P10 (≠ M21), K38 (≠ R54), P39 (≠ V55), F145 (≠ L162), E149 (= E166), M276 (≠ Y303)
- binding flavin-adenine dinucleotide: V6 (≠ I17), G7 (= G18), G9 (= G20), P10 (≠ M21), G11 (≠ V22), D29 (≠ S45), K30 (≠ E46), K38 (≠ R54), P39 (≠ V55), E74 (≠ P89), A75 (≠ V90), A100 (= A115), T101 (= T116), G102 (= G117), L119 (≠ Y136), R120 (= R137), F145 (≠ L162), I146 (≠ L163), E149 (= E166), G259 (= G286), D260 (≠ E287), G270 (= G297), T271 (≠ L298), A272 (≠ V299)
6rvhA Nadh-dependent coenzyme a disulfide reductase soaked with menadione (see paper)
30% identity, 25% coverage: 77:289/853 of query aligns to 68:283/443 of 6rvhA
Sites not aligning to the query:
- active site: 39, 44, 53, 58, 425, 430
- binding coenzyme a: 20, 23, 40, 41, 44, 63, 303, 307, 359, 431, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 34, 35, 43, 44, 297, 298, 299, 424, 425
- binding menadione: 364, 365, 430, 431
6rvbA Nadh-dependent coenzyme a disulfide reductase soaked with nadh (see paper)
30% identity, 25% coverage: 77:289/853 of query aligns to 68:283/443 of 6rvbA
- active site: Y159 (≠ L162), E163 (= E166)
- binding flavin-adenine dinucleotide: E80 (≠ P89), V81 (= V90), T113 (= T116), G114 (= G117), L133 (≠ Y136), R134 (= R137), I160 (≠ L163), G280 (= G286), D281 (≠ E287)
- binding nicotinamide-adenine-dinucleotide: G156 (= G159), G158 (= G161), Y159 (≠ L162), I160 (≠ L163), E179 (= E182), A180 (≠ F183), A240 (≠ S246), T241 (≠ A247), G242 (= G248)
Sites not aligning to the query:
- active site: 39, 44, 53, 58, 425, 430
- binding coenzyme a: 15, 20, 23, 40, 41, 44, 63, 303, 307, 359, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 33, 34, 35, 36, 43, 44, 298, 299, 424, 425
- binding nicotinamide-adenine-dinucleotide: 297, 328, 329
6ruzA Nadh-dependent coenzyme a disulfide reductase (see paper)
30% identity, 25% coverage: 77:289/853 of query aligns to 68:283/443 of 6ruzA
- active site: Y159 (≠ L162), E163 (= E166)
- binding flavin-adenine dinucleotide: E80 (≠ P89), V81 (= V90), T113 (= T116), G114 (= G117), A115 (≠ S118), L133 (≠ Y136), R134 (= R137), Y159 (≠ L162), G280 (= G286), D281 (≠ E287)
Sites not aligning to the query:
- active site: 39, 44, 53, 58, 425, 430
- binding coenzyme a: 15, 19, 20, 23, 40, 41, 44, 63, 303, 307, 359, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 33, 34, 35, 43, 44, 297, 298, 299, 424, 425
3nt6A Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c43s/c531s double mutant (see paper)
29% identity, 33% coverage: 57:341/853 of query aligns to 45:362/565 of 3nt6A
- active site: N325 (≠ Y303)
- binding coenzyme a: A321 (≠ V299), N325 (≠ Y303), R329 (= R307)
- binding flavin-adenine dinucleotide: E80 (≠ P89), V81 (= V90), S112 (≠ A115), P113 (≠ T116), G114 (= G117), L133 (≠ Y136), R134 (= R137), F161 (≠ L162), G302 (= G286), D303 (≠ E287), P319 (vs. gap), L320 (= L298), A321 (≠ V299)
Sites not aligning to the query:
- active site: 11, 38, 42, 43, 471, 472
- binding coenzyme a: 11, 18, 19, 22, 39, 42, 43, 459, 462, 463, 466, 534, 535
- binding flavin-adenine dinucleotide: 7, 8, 10, 11, 12, 33, 34, 42, 43
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
29% identity, 38% coverage: 13:338/853 of query aligns to 3:337/404 of 3fg2P
- binding flavin-adenine dinucleotide: G8 (= G18), G10 (= G20), H11 (≠ M21), A12 (≠ V22), D34 (≠ E46), E35 (= E47), R42 (= R54), P43 (≠ V55), S46 (= S58), K47 (≠ E59), R78 (≠ P89), M79 (≠ V90), T106 (= T116), R127 (= R137), I153 (≠ L163), D275 (≠ E287), S292 (≠ L298), V293 (= V299), W321 (≠ T322)
5vn0A Water-forming nadh oxidase from lactobacillus brevis (lbnox) bound to nadh. (see paper)
26% identity, 32% coverage: 14:290/853 of query aligns to 4:283/449 of 5vn0A
- active site: H11 (≠ M21), I38 (≠ R50), L41 (≠ D53), S42 (≠ R54), C43 (≠ V55), Q75 (≠ H85), T102 (vs. gap), A277 (= A284), A282 (= A289), A283 (= A290)
- binding flavin-adenine dinucleotide: G8 (= G18), T10 (≠ G20), H11 (≠ M21), A12 (≠ V22), E33 (≠ S45), R34 (≠ E46), N35 (≠ E47), S42 (≠ R54), C43 (≠ V55), N79 (≠ P89), V80 (= V90), T111 (≠ A115), S112 (≠ T116), G113 (= G117), K133 (≠ R137), G279 (= G286), D280 (≠ E287)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G157 (= G161), Y158 (≠ L162), I159 (≠ L163), E162 (= E166), D178 (≠ E182), A179 (≠ F183), K186 (≠ V190), Y187 (≠ Q191), I241 (≠ A247), G242 (= G248), F243 (≠ I249)
Sites not aligning to the query:
5er0A Water-forming nadh oxidase from lactobacillus brevis (lbnox) (see paper)
26% identity, 32% coverage: 14:290/853 of query aligns to 4:283/450 of 5er0A
- active site: H11 (≠ M21), I38 (≠ R50), L41 (≠ D53), S42 (≠ R54), C43 (≠ V55), Q75 (≠ H85), T102 (vs. gap), A277 (= A284), A282 (= A289), A283 (= A290)
- binding flavin-adenine dinucleotide: G8 (= G18), T10 (≠ G20), H11 (≠ M21), A12 (≠ V22), E33 (≠ S45), R34 (≠ E46), S42 (≠ R54), C43 (≠ V55), N79 (≠ P89), V80 (= V90), S112 (≠ T116), G113 (= G117), K133 (≠ R137), Y158 (≠ L162), I159 (≠ L163), N246 (≠ Q252), G279 (= G286), D280 (≠ E287)
Sites not aligning to the query:
8pxkA Structure of nadh-dependent ferredoxin reductase, bpha4, solved at wavelength 5.76 a (see paper)
30% identity, 33% coverage: 14:297/853 of query aligns to 7:280/403 of 8pxkA
- binding flavin-adenine dinucleotide: G13 (= G20), A15 (≠ V22), D37 (≠ E46), E38 (= E47), R45 (= R54), P46 (≠ V55), K50 (≠ E59), A79 (≠ V90), T106 (= T116), G107 (= G117), R127 (= R137), I153 (≠ L163), G269 (= G286), D270 (≠ E287)
Sites not aligning to the query:
2yvjA Crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex (see paper)
30% identity, 33% coverage: 14:297/853 of query aligns to 6:279/402 of 2yvjA
- active site: L13 (≠ M21), R44 (= R54), P45 (≠ V55)
- binding flavin-adenine dinucleotide: G10 (= G18), G12 (= G20), G35 (≠ S45), D36 (≠ E46), E37 (= E47), R44 (= R54), P45 (≠ V55), A78 (≠ V90), T105 (= T116), G106 (= G117), R126 (= R137), G268 (= G286), D269 (≠ E287)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V147 (= V158), G148 (= G159), G149 (= G160), G150 (= G161), I152 (≠ L163), V170 (= V181), E171 (= E182), T172 (≠ F183), R179 (≠ L198), G230 (≠ S246), I231 (≠ A247), G232 (= G248), V233 (≠ I249)
Sites not aligning to the query:
2gr2A Crystal structure of ferredoxin reductase, bpha4 (oxidized form)
30% identity, 33% coverage: 14:297/853 of query aligns to 5:278/401 of 2gr2A
- active site: L12 (≠ M21), R43 (= R54), P44 (≠ V55)
- binding adenosine-5-diphosphoribose: R109 (vs. gap), V146 (= V158), G147 (= G159), G149 (= G161), V150 (≠ L162), I151 (≠ L163), E170 (= E182), T171 (≠ F183), R178 (≠ L198), G229 (≠ S246), I230 (≠ A247), G231 (= G248)
- binding flavin-adenine dinucleotide: G11 (= G20), A13 (≠ V22), D35 (≠ E46), E36 (= E47), R43 (= R54), P44 (≠ V55), K48 (≠ E59), A77 (≠ V90), T104 (= T116), G105 (= G117), R125 (= R137), G267 (= G286), D268 (≠ E287)
Sites not aligning to the query:
2gr0A Crystal structure of ferredoxin reductase, bpha4 (oxidized form, NAD+ complex) (see paper)
30% identity, 33% coverage: 14:297/853 of query aligns to 5:278/401 of 2gr0A
- active site: L12 (≠ M21), R43 (= R54), P44 (≠ V55)
- binding adenosine-5'-diphosphate: V146 (= V158), G147 (= G159), G149 (= G161), I151 (≠ L163), E170 (= E182), T171 (≠ F183), R178 (≠ L198), G229 (≠ S246), I230 (≠ A247), G231 (= G248)
- binding flavin-adenine dinucleotide: G11 (= G20), A13 (≠ V22), D35 (≠ E46), E36 (= E47), R43 (= R54), P44 (≠ V55), K48 (≠ E59), T76 (≠ P89), A77 (≠ V90), T104 (= T116), G105 (= G117), R125 (= R137), I151 (≠ L163), G267 (= G286), D268 (≠ E287)
Sites not aligning to the query:
1f3pA Ferredoxin reductase (bpha4)-nadh complex (see paper)
30% identity, 33% coverage: 14:297/853 of query aligns to 6:279/401 of 1f3pA
- active site: L13 (≠ M21), R44 (= R54), P45 (≠ V55)
- binding flavin-adenine dinucleotide: A14 (≠ V22), V34 (≠ F44), D36 (≠ E46), E37 (= E47), R44 (= R54), P45 (≠ V55), A78 (≠ V90), T105 (= T116), G106 (= G117), R126 (= R137), G268 (= G286), D269 (≠ E287)
- binding nicotinamide-adenine-dinucleotide: V147 (= V158), G148 (= G159), G150 (= G161), V151 (≠ L162), I152 (≠ L163), E155 (= E166), E171 (= E182), T172 (≠ F183), R179 (≠ L198), G230 (≠ S246), I231 (≠ A247), G232 (= G248), V233 (≠ I249)
Sites not aligning to the query:
Query Sequence
>Pf6N2E2_1114 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1114
MNSNVASLNKLQTLIVIGNGMVGHHCVEQLIERGALNHYRVHVFSEEPMRAYDRVHLSEY
FSGRDAESLALGEASLYQTPGITLHLGVPVLEIDRDAHQVVTAHDRLHYDKLVLATGSYP
FVPPIEGAEGDSCLVYRTLEDLDAIRAAASNARRGVVVGGGLLGLEAANALKTLGLEAHV
VEFAPRLMPVQLDPQGGLALKARIEKLGVGVHLSKGTQSISAGEQYRYRMNFGDDDFLET
DLIVFSAGIRAQDALARQSDLQIGPRGGVVIDDHCQSSDPDIYAIGECAAWNGSIFGLVA
PGYQMARNVAARLCGESADAFTGADMSTKLKLLGVDVGSIGDAHGNTPGSRSFQFIDETS
ASYRRLVVDAAGKRVIGAVLVGDNSYYDTLLQYMQNGIALPKDAASLILPSSEGAPTLGP
AALPETATICSCHNVTKGSICSAIDGGCTDLGQLKCDTKAGTGCGGCAALVKQVFEHELT
ARGVSVDKSLCEHFAYTRQELYALVRVEGIISFEELLAKHGRGHTGCDLCKPAVGSILAS
CWNQPIMDPSLVPLQDTNDTFMANMQKNGTYSVVPRIAGGEITADKLIAIGVVAKKYDLY
TKITGGQRIDLFGAQLHQLPDIWAELIEAGFETGHAYGKSTRTVKSCVGSTWCRYGVQDS
VQMALTLEDRYKGLRSPHKLKFAVSGCTRECAEAQSKDVGVIATEKGWNLYVAGNGGMRP
RHAELFATDLDDATLIRYIDRFLMFYIRTADKLQRTSVWRESLEGGLDYLKEVIIDDSLG
LGAELEAQMQLVVDRYECEWANALKDPDKLKRFRTFVNDGRGDPDVHFVRERGQRRPVHA
HELHLIPVTEEVL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory