SitesBLAST
Comparing Pf6N2E2_1145 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1145 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6aqpA Aspergillus fumigatus cytosolic thiolase: acetylated enzyme in complex with coa and potassium ions
53% identity, 99% coverage: 2:395/396 of query aligns to 2:397/397 of 6aqpA
- active site: C93 (= C91), H353 (= H351), C383 (= C381), G385 (= G383)
- binding coenzyme a: C93 (= C91), L153 (= L151), Y188 (≠ T187), N226 (≠ K225), N228 (≠ R227), K231 (= K230), A248 (= A246), P249 (≠ A247), S252 (= S250), A323 (= A321), F324 (= F322), H353 (= H351)
Q4WCL5 Acetyl-CoA acetyltransferase erg10B, cytosolic; Acetoacetyl-CoA thiolase erg10B; ACAT; Cytosolic thiolase erg10B; CT; Ergosterol biosynthesis protein 10B; EC 2.3.1.9 from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata)
52% identity, 99% coverage: 2:395/396 of query aligns to 1:398/398 of Q4WCL5
- Y187 (≠ T187) binding
- N229 (≠ R227) binding
- K232 (= K230) binding
- A249 (= A246) binding
- P250 (≠ A247) binding
- S252 (≠ A249) binding
- S253 (= S250) binding
- V350 (≠ C347) binding
- N385 (≠ I382) binding
6aqpC Aspergillus fumigatus cytosolic thiolase: acetylated enzyme in complex with coa and potassium ions
52% identity, 99% coverage: 2:395/396 of query aligns to 2:399/399 of 6aqpC
- active site: C93 (= C91), H355 (= H351), C385 (= C381), G387 (= G383)
- binding acetyl coenzyme *a: C93 (= C91), L153 (= L151), M162 (= M161), Y188 (≠ T187), N230 (≠ R227), K233 (= K230), L234 (≠ I231), I237 (≠ L234), A250 (= A246), P251 (≠ A247), S254 (= S250), F295 (= F291), A325 (= A321), F326 (= F322), H355 (= H351)
P45359 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; CaTHL; EC 2.3.1.9 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
49% identity, 98% coverage: 7:393/396 of query aligns to 4:390/392 of P45359
- V77 (≠ K80) mutation to Q: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Y-153 and K-286.
- C88 (= C91) modified: Disulfide link with 378, In inhibited form
- S96 (≠ I99) binding
- N153 (≠ D156) mutation to Y: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Q-77 and K-286.
- GS 279:280 (≠ AA 282:283) binding
- A286 (≠ S289) mutation to K: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Q-77 and Y-153.
- C378 (= C381) modified: Disulfide link with 88, In inhibited form
- A386 (= A389) binding
4xl4A Crystal structure of thiolase from clostridium acetobutylicum in complex with coa (see paper)
49% identity, 98% coverage: 7:393/396 of query aligns to 4:390/392 of 4xl4A
- active site: C88 (= C91), H348 (= H351), S378 (≠ C381), G380 (= G383)
- binding coenzyme a: L148 (= L151), H156 (≠ R159), R220 (≠ P224), L231 (= L234), A243 (= A246), S247 (= S250), F319 (= F322), H348 (= H351)
7cw5B Acetyl-coa acetyltransferase from bacillus cereus atcc 14579 (see paper)
49% identity, 98% coverage: 8:394/396 of query aligns to 4:391/394 of 7cw5B
- active site: C87 (= C91), H348 (= H351), C378 (= C381), G380 (= G383)
- binding coenzyme a: L147 (= L151), H155 (≠ L160), M156 (= M161), R220 (≠ P224), T223 (≠ A226), A243 (= A246), P247 (≠ S250), L249 (≠ I252), H348 (= H351)
6bn2A Crystal structure of acetyl-coa acetyltransferase from elizabethkingia anophelis nuhp1
47% identity, 98% coverage: 7:395/396 of query aligns to 4:392/393 of 6bn2A
P41338 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Ergosterol biosynthesis protein 10; EC 2.3.1.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
49% identity, 98% coverage: 7:393/396 of query aligns to 5:396/398 of P41338
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
P14611 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
49% identity, 98% coverage: 7:393/396 of query aligns to 4:391/393 of P14611
- C88 (= C91) active site, Acyl-thioester intermediate; mutation to S: Almost complete loss of acetoacetyl-CoA thiolase activity.
- H156 (≠ R159) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- F219 (≠ Q222) mutation to A: About 50% loss of acetoacetyl-CoA thiolase activity.; mutation to Y: 2-fold increase of acetoacetyl-CoA thiolase activity.
- R221 (≠ P224) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- S248 (= S250) mutation to A: About 40% loss of acetoacetyl-CoA thiolase activity.
- H349 (= H351) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- C379 (= C381) mutation to S: Almost complete loss of acetoacetyl-CoA thiolase activity.
4o9cC Crystal structure of beta-ketothiolase (phaa) from ralstonia eutropha h16 (see paper)
48% identity, 98% coverage: 7:393/396 of query aligns to 4:391/393 of 4o9cC
- active site: S88 (≠ C91), H349 (= H351), C379 (= C381), G381 (= G383)
- binding coenzyme a: S88 (≠ C91), L148 (= L151), R221 (≠ P224), F236 (= F238), A244 (= A246), S248 (= S250), L250 (≠ I252), A319 (= A321), F320 (= F322), H349 (= H351)
Q9BWD1 Acetyl-CoA acetyltransferase, cytosolic; Acetyl-CoA transferase-like protein; Cytosolic acetoacetyl-CoA thiolase; EC 2.3.1.9 from Homo sapiens (Human) (see 2 papers)
48% identity, 98% coverage: 4:393/396 of query aligns to 5:395/397 of Q9BWD1
- K211 (= K212) to R: in dbSNP:rs25683
- R223 (≠ P224) binding
- S226 (≠ A226) binding
- S252 (= S250) binding
1wl4A Human cytosolic acetoacetyl-coa thiolase complexed with coa (see paper)
48% identity, 98% coverage: 4:393/396 of query aligns to 2:392/394 of 1wl4A
- active site: C89 (= C91), H350 (= H351), C380 (= C381), G382 (= G383)
- binding coenzyme a: L148 (= L151), M157 (= M161), R220 (≠ P224), Y234 (≠ A237), P245 (≠ A246), A246 (= A247), S249 (= S250), A320 (= A321), F321 (= F322), H350 (= H351)
1ou6A Biosynthetic thiolase from zoogloea ramigera in complex with acetyl-o- pantetheine-11-pivalate
47% identity, 99% coverage: 3:395/396 of query aligns to 1:392/392 of 1ou6A
- active site: C89 (= C91), H348 (= H351), C378 (= C381), G380 (= G383)
- binding pantothenyl-aminoethanol-acetate pivalic acid: L148 (= L151), H156 (≠ L160), M157 (= M161), F235 (= F238), A243 (= A246), S247 (= S250), A318 (= A321), F319 (= F322), H348 (= H351)
2vu2A Biosynthetic thiolase from z. Ramigera. Complex with s-pantetheine-11- pivalate. (see paper)
47% identity, 98% coverage: 7:395/396 of query aligns to 2:389/389 of 2vu2A
- active site: C86 (= C91), H345 (= H351), C375 (= C381), G377 (= G383)
- binding (3R)-3-hydroxy-2,2-dimethyl-4-oxo-4-({3-oxo-3-[(2-sulfanylethyl)amino]propyl}amino)butyl 2,2-dimethylpropanoate: H153 (≠ L160), M154 (= M161), F232 (= F238), S244 (= S250), G245 (≠ S251), F316 (= F322), H345 (= H351)
1dm3A Acetylated biosynthetic thiolase from zoogloea ramigera in complex with acetyl-coa (see paper)
47% identity, 98% coverage: 7:395/396 of query aligns to 2:389/389 of 1dm3A
- active site: C86 (= C91), H345 (= H351), C375 (= C381), G377 (= G383)
- binding acetyl coenzyme *a: C86 (= C91), L145 (= L151), H153 (≠ L160), M154 (= M161), R217 (≠ P224), S224 (≠ K230), M225 (≠ I231), A240 (= A246), S244 (= S250), M285 (≠ F291), A315 (= A321), F316 (= F322), H345 (= H351), C375 (= C381)
1dlvA Biosynthetic thiolase from zoogloea ramigera in complex with coa (see paper)
47% identity, 98% coverage: 7:395/396 of query aligns to 2:389/389 of 1dlvA
- active site: C86 (= C91), H345 (= H351), C375 (= C381), G377 (= G383)
- binding coenzyme a: C86 (= C91), L145 (= L151), H153 (≠ L160), M154 (= M161), R217 (≠ P224), L228 (= L234), A240 (= A246), S244 (= S250), H345 (= H351)
2vu1A Biosynthetic thiolase from z. Ramigera. Complex of with o-pantheteine- 11-pivalate. (see paper)
47% identity, 98% coverage: 7:395/396 of query aligns to 4:391/391 of 2vu1A
2wkuA Biosynthetic thiolase from z. Ramigera. The n316h mutant. (see paper)
47% identity, 98% coverage: 7:395/396 of query aligns to 2:389/389 of 2wkuA
- active site: C86 (= C91), H345 (= H351), C375 (= C381), G377 (= G383)
- binding D-mannose: S6 (= S11), A7 (= A12), R38 (= R43), K182 (≠ R189), D194 (≠ A201), V280 (≠ D286), D281 (≠ T287), T287 (= T293), P331 (≠ H337), S332 (≠ D338), V334 (= V340), V336 (= V342), F360 (≠ S366)
P24752 Acetyl-CoA acetyltransferase, mitochondrial; Acetoacetyl-CoA thiolase; T2; EC 2.3.1.9 from Homo sapiens (Human) (see 6 papers)
47% identity, 98% coverage: 7:395/396 of query aligns to 42:427/427 of P24752
- N93 (≠ C58) to S: in 3KTD; decreased acetyl-CoA C-acyltransferase activity; less than 10% of the degradative/thiolase activity; dbSNP:rs120074145
- N158 (= N123) to D: in 3KTD; loss of acetyl-CoA C-acyltransferase activity; no degradative/thiolase activity; dbSNP:rs148639841
- G183 (= G150) to R: in 3KTD; no activity; dbSNP:rs120074141
- Y219 (≠ T187) binding ; binding
- RVD 258:260 (≠ KAR 225:227) binding
- K263 (= K230) binding
- A280 (= A246) binding
- A281 (= A247) binding
- A283 (= A249) binding
- S284 (= S250) binding
- T297 (≠ R263) to M: in 3KTD; decreased protein abundance; decreased acetyl-CoA C-acyltransferase activity; less than 10% of the degradative/thiolase activity; dbSNP:rs886041122
- A301 (= A267) to P: in 3KTD; loss of acetyl-CoA C-acyltransferase activity; no degradative/thiolase activity; dbSNP:rs1420321267
- I312 (= I278) to T: in 3KTD; decreased protein stability; decreased acetyl-CoA C-acyltransferase activity; less than 10% of the degradative/thiolase activity; dbSNP:rs120074146
- A333 (≠ V299) to P: in 3KTD; loss of protein solubility; loss of acetyl-CoA C-acyltransferase activity; no degradative/thiolase activity; dbSNP:rs120074147
- A380 (= A346) to T: in 3KTD; decreased protein stability; dbSNP:rs120074140
- V381 (≠ C347) binding
Sites not aligning to the query:
- 5 A → P: in dbSNP:rs3741056
2ib8D Crystallographic and kinetic studies of human mitochondrial acetoacetyl-coa thiolase (t2): the importance of potassium and chloride for its structure and function (see paper)
47% identity, 98% coverage: 7:395/396 of query aligns to 8:393/393 of 2ib8D
Query Sequence
>Pf6N2E2_1145 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1145
MMSNDPIVIVSAVRTPMGGFQGELKSLTAPQLGAAAIKAAVERAGIAPGVVEEVLFGCVL
AAGQGQAPARQAALGAGLDKSTRCTTLNKMCGSGMEATILAHDMLIAGSAEVVVAGGMES
MSNAPYLLDRARGGYRMGHGRVLDHMFLDGLEDAYDKGRLMGTFAEDCAEANGLSREAQD
AFAIASTTRAQQAIKDGSFDAEIVPLQVMVGKEQVTIRHDEQPPKARIDKIASLKPAFRE
GGTVTAANASSISDGAAALVLMRQSQAAQRGLKPLAVIHGHAAFADTPSLFPTAPIGAVK
KLMQKTGWSLDQVDLFEVNEAFAVVGLVTMDKLEIAHDKVNVHGGACALGHPIGASGARI
LVTLLSALRQKGLKRGVAAICIGGGEATAMAVECLY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory