Comparing Pf6N2E2_1184 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1184 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
26% identity, 37% coverage: 61:222/434 of query aligns to 87:236/444 of Q8NLB7
Sites not aligning to the query:
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
23% identity, 70% coverage: 66:370/434 of query aligns to 70:413/491 of P0AGF4
Sites not aligning to the query:
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
23% identity, 70% coverage: 66:370/434 of query aligns to 66:409/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
23% identity, 70% coverage: 66:370/434 of query aligns to 66:409/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
23% identity, 70% coverage: 66:370/434 of query aligns to 66:409/475 of 4gbyA
8sc3A Human oct1 bound to fenoterol in inward-open conformation (see paper)
24% identity, 76% coverage: 56:384/434 of query aligns to 136:414/445 of 8sc3A
>Pf6N2E2_1184 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1184
LDSQGRERRKLVLAVSVGAALEWFDFTLFAIFSLQIAAAFFPASDPLMSLLASYLALAVG
FVARPLGALLMGRYADRQGRKAALTLSIMLMGAGTLIIAVCPTYETIGWWAPLSVVVARI
LQGVAAGGEIGGALAYLVETAPADRRALFASSQQVAQAGSFLLCGLSASLLSSALTPAQL
DEWGWRVPYVFGLLVVVAGLKIRRSLEESEPLRRFLDNQDKHAMAGKGPSLRPYLPNLVM
GVLIVVLWTVATQLINFIPTYASMVLELPRNKAYLGLVLVGLITLLCPLTALLSDRIGRY
TVMLIGAVGVALCAYPGFVWLNNSPSLQTLIIFQCALAVLMVLYTGPAAAALAELFPVQV
RALGVSLAYALSVTLFGSATPALITLIYRQSGDALAAAHWLFAAACLSAIPLAWVSLSKY
RASATPALTAEHET
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory