Comparing Pf6N2E2_1301 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1301 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
39% identity, 91% coverage: 28:334/339 of query aligns to 2:309/310 of 7bbrA
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
39% identity, 91% coverage: 28:334/339 of query aligns to 1:308/310 of 7bcrA
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
39% identity, 91% coverage: 28:334/339 of query aligns to 1:308/310 of 7bcpA
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
39% identity, 91% coverage: 28:334/339 of query aligns to 1:308/310 of 7bcoA
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
39% identity, 91% coverage: 28:334/339 of query aligns to 1:308/310 of 7bcnA
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
35% identity, 86% coverage: 34:325/339 of query aligns to 4:294/303 of 4pddA
4nq8B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate (see paper)
36% identity, 88% coverage: 31:328/339 of query aligns to 1:296/301 of 4nq8B
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
36% identity, 86% coverage: 31:320/339 of query aligns to 1:289/301 of 4pdhA
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
35% identity, 88% coverage: 31:330/339 of query aligns to 3:302/304 of 4x8rA
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
35% identity, 86% coverage: 31:320/339 of query aligns to 4:292/304 of 4pakA
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
35% identity, 86% coverage: 31:320/339 of query aligns to 3:291/303 of 4p9kA
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
35% identity, 84% coverage: 32:317/339 of query aligns to 1:285/300 of 4n8yA
4pf8A Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. Nas-14.1 (target efi-510299) with bound beta-d- galacturonate (see paper)
34% identity, 82% coverage: 40:316/339 of query aligns to 8:283/300 of 4pf8A
Sites not aligning to the query:
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
33% identity, 86% coverage: 45:334/339 of query aligns to 16:313/314 of 4p8bA
4xeqB Crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid
37% identity, 78% coverage: 50:312/339 of query aligns to 20:280/304 of 4xeqB
Sites not aligning to the query:
4p3lA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_2479), target efi-510085, with bound glucuronate, spg p6122 (see paper)
31% identity, 81% coverage: 44:318/339 of query aligns to 13:286/303 of 4p3lA
Sites not aligning to the query:
Q128M1 Solute-binding protein Bpro_3107 from Polaromonas sp. (strain JS666 / ATCC BAA-500) (see paper)
35% identity, 83% coverage: 39:321/339 of query aligns to 39:318/330 of Q128M1
4mijA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-galacturonate, space group p21 (see paper)
35% identity, 83% coverage: 39:321/339 of query aligns to 9:288/302 of 4mijA
4mhfA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-glucuronate, space group p21 (see paper)
35% identity, 83% coverage: 39:321/339 of query aligns to 9:288/301 of 4mhfA
4ovrA Crystal structure of a trap periplasmic solute binding protein from xanthobacter autotrophicus py2, target efi-510329, with bound beta-d- galacturonate (see paper)
34% identity, 84% coverage: 32:316/339 of query aligns to 1:282/298 of 4ovrA
>Pf6N2E2_1301 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1301
MGQLMKTLLAGACATGLLLGSVVSHADEIRERTLRFAFQNVKEHPQGQGAQKFADLLSEK
SGGKIKVRLFPGGTLGGDVQTVSALQGGTLDITVLNSGILAAQAPDYAMLDFPFLFNNVE
EAHAVIDGPVGQKLAVQLDSKGLVALGYWDLGFRNLTNSKHPVTKLEDMQGLKIRVIQSP
IYLETFSALGANPVPMAFPEVYTGLEQHTIDGQENPFTVIEGNKFYEVQKYLSVTGHIFN
PQSLIISQKTWNRLNDDEKAMIRSAATEAQKFQREVTAASMDKAKVTLAGAMTVNEVTPA
EKDRFRERVKPVVDKFAKSLDADLVKTMYEEIAKVRAAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory