Comparing Pf6N2E2_1339 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1339 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
35% identity, 96% coverage: 12:389/394 of query aligns to 10:378/380 of 7rsfA
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
26% identity, 89% coverage: 34:384/394 of query aligns to 27:370/377 of P44514
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
26% identity, 89% coverage: 34:384/394 of query aligns to 31:374/380 of 5vo3A
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
29% identity, 69% coverage: 74:344/394 of query aligns to 64:330/377 of 7t1qA
Sites not aligning to the query:
7lgpB Dape enzyme from shigella flexneri
32% identity, 49% coverage: 72:265/394 of query aligns to 63:259/377 of 7lgpB
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
26% identity, 87% coverage: 7:347/394 of query aligns to 1:333/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
26% identity, 87% coverage: 7:347/394 of query aligns to 1:333/375 of 4pqaA
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium
25% identity, 97% coverage: 6:389/394 of query aligns to 5:383/383 of 7uoiA
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
24% identity, 82% coverage: 70:394/394 of query aligns to 73:408/408 of Q03154
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
32% identity, 48% coverage: 72:261/394 of query aligns to 99:289/426 of 3pfoA
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
30% identity, 54% coverage: 72:284/394 of query aligns to 75:294/407 of P37111
Sites not aligning to the query:
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
28% identity, 94% coverage: 6:374/394 of query aligns to 1:351/366 of Q8P8J5
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
28% identity, 94% coverage: 6:374/394 of query aligns to 2:346/360 of 2f7vA
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
32% identity, 36% coverage: 34:174/394 of query aligns to 29:170/258 of 4h2kA
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
39% identity, 24% coverage: 60:153/394 of query aligns to 114:211/507 of Q96KN2
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
39% identity, 24% coverage: 60:153/394 of query aligns to 83:180/471 of 3dljA
Sites not aligning to the query:
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
26% identity, 53% coverage: 72:280/394 of query aligns to 86:350/458 of 2pokA
Sites not aligning to the query:
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
33% identity, 40% coverage: 13:171/394 of query aligns to 7:165/265 of 4op4B
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
24% identity, 76% coverage: 74:374/394 of query aligns to 74:356/373 of 3rzaA
Sites not aligning to the query:
7m6uB Crystal structure of a circular permutation and computationally designed pro-enzyme of carboxypeptidase g2 (see paper)
27% identity, 59% coverage: 59:289/394 of query aligns to 4:222/392 of 7m6uB
Sites not aligning to the query:
>Pf6N2E2_1339 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1339
MGCRVMSELRSRALLAELVSFATVSRDSNLALIEFVRDYLQGLGVNSELIYNAERTKANL
LASIGPAVPGGVVLSGHTDVVPVDGQAWTVDPFCLTEMDGKWFGRGTADMKGYLASVLAA
VPVFLSSPLRRPVHLAFSYDEEVGCLGVHSLLEVLVRRIAQPALCLIGEPTQLRPVLGHK
GKLAMRCHVRGAACHSAYAPYGVNAIEQAARLIGRLGEIGAQLAEPSRHDPRFDPACSTV
QVGVVHGGTALNIVPADCRFDFEVRALPDFDPLVVVEQLQGYAEQTLLPAMQAVAGDTAI
RFEPLSAYPGLATSPDSAAARLIAQLCGSDAFGTVAFGTEGGLFHQAGVPTVVCGPGSMD
QGHKPDEYVSVEQMAACDRLMDRLASYLCEPNDC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory