SitesBLAST
Comparing Pf6N2E2_137 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_137 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 86% coverage: 41:481/511 of query aligns to 23:453/459 of P9WIT1
- K354 (≠ E377) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
31% identity, 88% coverage: 34:482/511 of query aligns to 11:462/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ A96), G75 (= G98), S76 (≠ A99), G77 (= G100), T78 (= T101), G79 (= G102), L80 (= L103), A83 (≠ G106), C84 (≠ A107), P137 (= P160), G138 (≠ S161), E139 (≠ S162), A142 (= A165), T143 (≠ S167), G146 (= G170), N147 (= N171), S149 (≠ A173), T150 (≠ E174), A152 (= A176), G153 (= G177), E203 (= E226), G204 (= G227), I209 (= I232), E422 (= E442), H423 (= H443)
- binding fe (iii) ion: H377 (= H398), H384 (= H405), E422 (= E442)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
30% identity, 81% coverage: 68:482/511 of query aligns to 40:453/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (≠ A96), G70 (= G98), T71 (≠ A99), G72 (= G100), T73 (= T101), G74 (= G102), G78 (= G106), V79 (≠ A107), L90 (≠ M118), P132 (= P160), G133 (≠ S161), A134 (≠ S162), G140 (= G170), M141 (≠ N171), A143 (= A173), T144 (≠ E174), A146 (= A176), S147 (≠ G177), E200 (= E226), G201 (= G227), I206 (= I232), W322 (≠ F353), E413 (= E442), H414 (= H443), N450 (= N479)
- binding lactic acid: R318 (= R349), H369 (= H398), H376 (= H405), H414 (= H443)
- binding manganese (ii) ion: H369 (= H398), H376 (= H405), E413 (= E442)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
29% identity, 88% coverage: 33:482/511 of query aligns to 6:463/465 of 3pm9A
- active site: A149 (= A176), L159 (= L186)
- binding flavin-adenine dinucleotide: P69 (≠ A96), Q70 (≠ R97), G71 (= G98), G72 (≠ A99), N73 (≠ G100), T74 (= T101), G75 (= G102), L76 (= L103), G79 (= G106), Q80 (≠ A107), L91 (≠ M118), L133 (≠ P160), G134 (≠ S161), A135 (≠ S162), C139 (= C166), T140 (≠ S167), G142 (= G169), G143 (= G170), S146 (≠ A173), T147 (≠ E174), A149 (= A176), G150 (= G177), E200 (= E226), G201 (= G227), I205 (≠ V231), I206 (= I232), E423 (= E442)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
30% identity, 81% coverage: 68:482/511 of query aligns to 40:454/456 of 8jdsA
- binding flavin-adenine dinucleotide: P68 (≠ A96), G70 (= G98), T71 (≠ A99), G72 (= G100), T73 (= T101), G74 (= G102), G78 (= G106), V79 (≠ A107), L90 (≠ M118), P132 (= P160), G133 (≠ S161), A134 (≠ S162), G140 (= G170), M141 (≠ N171), A143 (= A173), T144 (≠ E174), A146 (= A176), S147 (≠ G177), E200 (= E226), G201 (= G227), I206 (= I232), W323 (≠ F353), E414 (= E442), H415 (= H443), N451 (= N479)
- binding manganese (ii) ion: H370 (= H398), H377 (= H405), E414 (= E442)
- binding pyruvic acid: R319 (= R349), H370 (= H398), H377 (= H405), H415 (= H443)
Sites not aligning to the query:
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
30% identity, 81% coverage: 68:482/511 of query aligns to 40:453/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R349), H369 (= H398), H376 (= H405), H414 (= H443)
- binding flavin-adenine dinucleotide: P68 (≠ A96), G70 (= G98), T71 (≠ A99), G72 (= G100), T73 (= T101), G74 (= G102), G78 (= G106), V79 (≠ A107), L90 (≠ M118), P132 (= P160), G133 (≠ S161), A134 (≠ S162), G140 (= G170), M141 (≠ N171), A143 (= A173), T144 (≠ E174), A146 (= A176), S147 (≠ G177), E200 (= E226), G201 (= G227), I206 (= I232), W322 (≠ F353), E413 (= E442), H414 (= H443), N450 (= N479)
- binding manganese (ii) ion: H369 (= H398), H376 (= H405), E413 (= E442)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
29% identity, 91% coverage: 24:486/511 of query aligns to 6:467/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (≠ G60), P76 (≠ A96), G78 (= G98), G79 (≠ A99), N80 (≠ G100), T81 (= T101), G82 (= G102), M83 (≠ L103), G86 (= G106), S87 (≠ A107), L140 (≠ P160), A142 (≠ S162), C146 (= C166), H147 (≠ S167), G150 (= G170), N151 (= N171), A153 (= A173), T154 (≠ E174), G208 (= G227), I212 (≠ V231), I213 (= I232), E423 (= E442), N460 (= N479)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
29% identity, 81% coverage: 68:482/511 of query aligns to 40:452/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L103), R317 (= R349), W321 (≠ F353), H368 (= H398), H375 (= H405), H413 (= H443)
- binding flavin-adenine dinucleotide: P68 (≠ A96), G70 (= G98), T71 (≠ A99), G72 (= G100), T73 (= T101), G74 (= G102), G78 (= G106), V79 (≠ A107), L90 (≠ M118), P132 (= P160), G133 (≠ S161), A134 (≠ S162), G140 (= G170), M141 (≠ N171), A143 (= A173), T144 (≠ E174), A146 (= A176), S147 (≠ G177), E200 (= E226), G201 (= G227), I206 (= I232), W321 (≠ F353), Y322 (≠ P354), E412 (= E442), H413 (= H443), N449 (= N479)
- binding manganese (ii) ion: H368 (= H398), H375 (= H405), E412 (= E442)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
29% identity, 81% coverage: 68:482/511 of query aligns to 40:453/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R349), W322 (≠ F353), H369 (= H398), H376 (= H405), H414 (= H443)
- binding flavin-adenine dinucleotide: P68 (≠ A96), G70 (= G98), T71 (≠ A99), G72 (= G100), T73 (= T101), G74 (= G102), G78 (= G106), V79 (≠ A107), L90 (≠ M118), P132 (= P160), G133 (≠ S161), A134 (≠ S162), G140 (= G170), M141 (≠ N171), A143 (= A173), T144 (≠ E174), A146 (= A176), S147 (≠ G177), E200 (= E226), G201 (= G227), I206 (= I232), W322 (≠ F353), E413 (= E442), N450 (= N479)
- binding manganese (ii) ion: H369 (= H398), H376 (= H405), E413 (= E442)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
29% identity, 91% coverage: 24:486/511 of query aligns to 5:466/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R349), T337 (≠ F353), K348 (≠ C365), Y379 (≠ V396), H381 (= H398), H388 (= H405), H423 (= H443)
- binding flavin-adenine dinucleotide: W39 (≠ G60), P75 (≠ A96), Q76 (≠ R97), G77 (= G98), G78 (≠ A99), N79 (≠ G100), T80 (= T101), G81 (= G102), M82 (≠ L103), G85 (= G106), S86 (≠ A107), L139 (≠ P160), G140 (≠ S161), A141 (≠ S162), C145 (= C166), G149 (= G170), N150 (= N171), A152 (= A173), T153 (≠ E174), G157 (= G178), G207 (= G227), I212 (= I232), E422 (= E442), N459 (= N479)
- binding zinc ion: H381 (= H398), H388 (= H405), E422 (= E442)
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
29% identity, 91% coverage: 24:486/511 of query aligns to 5:466/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (≠ G60), P75 (≠ A96), G77 (= G98), G78 (≠ A99), N79 (≠ G100), T80 (= T101), G81 (= G102), G85 (= G106), S86 (≠ A107), L139 (≠ P160), G140 (≠ S161), A141 (≠ S162), C145 (= C166), H146 (≠ S167), G148 (= G169), G149 (= G170), N150 (= N171), A152 (= A173), T153 (≠ E174), A155 (= A176), E206 (= E226), G207 (= G227), I211 (≠ V231), I212 (= I232), E422 (= E442), N459 (= N479)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R349), T337 (≠ F353), K348 (≠ C365), Y379 (≠ V396), H381 (= H398), H388 (= H405), H423 (= H443)
- binding zinc ion: H381 (= H398), H388 (= H405), E422 (= E442)
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
29% identity, 91% coverage: 24:486/511 of query aligns to 5:466/466 of 6lpqA
- binding flavin-adenine dinucleotide: W39 (≠ G60), P75 (≠ A96), G77 (= G98), G78 (≠ A99), N79 (≠ G100), T80 (= T101), G81 (= G102), G85 (= G106), S86 (≠ A107), L139 (≠ P160), G140 (≠ S161), A141 (≠ S162), C145 (= C166), H146 (≠ S167), G149 (= G170), N150 (= N171), A152 (= A173), T153 (≠ E174), A155 (= A176), G157 (= G178), E206 (= E226), G207 (= G227), I211 (≠ V231), I212 (= I232), E422 (= E442), N459 (= N479)
- binding d-malate: M82 (≠ L103), R333 (= R349), T337 (≠ F353), K348 (≠ C365), Y379 (≠ V396), H381 (= H398), H388 (= H405), E422 (= E442), H423 (= H443)
- binding zinc ion: H381 (= H398), H388 (= H405), E422 (= E442)
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
29% identity, 91% coverage: 24:486/511 of query aligns to 5:466/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R349), T337 (≠ F353), K348 (≠ C365), Y379 (≠ V396), H381 (= H398), H388 (= H405), N390 (≠ L407), H423 (= H443)
- binding flavin-adenine dinucleotide: W39 (≠ G60), P75 (≠ A96), G77 (= G98), G78 (≠ A99), N79 (≠ G100), T80 (= T101), G81 (= G102), M82 (≠ L103), G85 (= G106), S86 (≠ A107), L139 (≠ P160), G140 (≠ S161), A141 (≠ S162), C145 (= C166), G149 (= G170), N150 (= N171), A152 (= A173), T153 (≠ E174), A155 (= A176), G157 (= G178), G207 (= G227), I212 (= I232), E422 (= E442), H423 (= H443)
- binding zinc ion: H381 (= H398), H388 (= H405), E422 (= E442)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
29% identity, 91% coverage: 24:486/511 of query aligns to 58:519/521 of Q8N465
- S109 (≠ V77) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V95) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (≠ A99) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ L115) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ F121) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ V140) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (≠ A157) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A173) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ I199) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G201) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (= D338) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R349) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ F353) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ Y363) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (≠ C365) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ A383) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ G390) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H398) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G400) to V: slight reduction in catalytic activity
- N439 (= N403) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H405) binding ; mutation to A: Loss of catalytic activity.
- N443 (≠ L407) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ I408) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ F410) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E442) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H443) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G444) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
29% identity, 81% coverage: 68:482/511 of query aligns to 40:453/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (≠ A96), G70 (= G98), T71 (≠ A99), G72 (= G100), T73 (= T101), G74 (= G102), G78 (= G106), V79 (≠ A107), L90 (≠ M118), P132 (= P160), G133 (≠ S161), A134 (≠ S162), G140 (= G170), M141 (≠ N171), A143 (= A173), T144 (≠ E174), A146 (= A176), S147 (≠ G177), E200 (= E226), G201 (= G227), I206 (= I232), H369 (= H398), E413 (= E442), N450 (= N479)
- binding deaminohydroxyvaline: R319 (= R349), H414 (= H443)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
29% identity, 81% coverage: 68:482/511 of query aligns to 40:454/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (≠ A96), G70 (= G98), T71 (≠ A99), G72 (= G100), T73 (= T101), G74 (= G102), G78 (= G106), V79 (≠ A107), L90 (≠ M118), P132 (= P160), G133 (≠ S161), A134 (≠ S162), G140 (= G170), M141 (≠ N171), A143 (= A173), T144 (≠ E174), A146 (= A176), S147 (≠ G177), E200 (= E226), G201 (= G227), I206 (= I232), Y324 (≠ P354), H370 (= H398), E414 (= E442), N451 (= N479)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R349), W323 (≠ F353), H415 (= H443)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
29% identity, 81% coverage: 68:482/511 of query aligns to 40:454/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R349), W323 (≠ F353), H370 (= H398), H415 (= H443)
- binding flavin-adenine dinucleotide: P68 (≠ A96), G70 (= G98), T71 (≠ A99), G72 (= G100), T73 (= T101), G74 (= G102), G78 (= G106), V79 (≠ A107), L90 (≠ M118), P132 (= P160), G133 (≠ S161), A134 (≠ S162), G140 (= G170), M141 (≠ N171), A143 (= A173), T144 (≠ E174), A146 (= A176), S147 (≠ G177), E200 (= E226), G201 (= G227), I206 (= I232), H370 (= H398), E414 (= E442), N451 (= N479)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
29% identity, 81% coverage: 68:482/511 of query aligns to 40:454/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R349), W323 (≠ F353), H415 (= H443)
- binding flavin-adenine dinucleotide: P68 (≠ A96), G70 (= G98), T71 (≠ A99), G72 (= G100), T73 (= T101), G74 (= G102), G78 (= G106), V79 (≠ A107), L90 (≠ M118), P132 (= P160), G133 (≠ S161), A134 (≠ S162), G140 (= G170), M141 (≠ N171), A143 (= A173), T144 (≠ E174), A146 (= A176), S147 (≠ G177), E200 (= E226), G201 (= G227), I206 (= I232), Y324 (≠ P354), H370 (= H398), E414 (= E442), N451 (= N479)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
29% identity, 81% coverage: 68:482/511 of query aligns to 40:454/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (≠ A96), G70 (= G98), T71 (≠ A99), G72 (= G100), T73 (= T101), G74 (= G102), G78 (= G106), V79 (≠ A107), L90 (≠ M118), P132 (= P160), G133 (≠ S161), A134 (≠ S162), G140 (= G170), M141 (≠ N171), A143 (= A173), T144 (≠ E174), A146 (= A176), S147 (≠ G177), E200 (= E226), G201 (= G227), I206 (= I232), H370 (= H398), E414 (= E442), N451 (= N479)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R349), W323 (≠ F353), H415 (= H443)
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
29% identity, 81% coverage: 68:482/511 of query aligns to 40:454/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (≠ A96), G70 (= G98), T71 (≠ A99), G72 (= G100), T73 (= T101), G74 (= G102), G78 (= G106), V79 (≠ A107), L90 (≠ M118), P132 (= P160), G133 (≠ S161), A134 (≠ S162), G140 (= G170), M141 (≠ N171), A143 (= A173), T144 (≠ E174), A146 (= A176), S147 (≠ G177), E200 (= E226), G201 (= G227), I206 (= I232), H370 (= H398), E414 (= E442), N451 (= N479)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R349), H415 (= H443)
Query Sequence
>Pf6N2E2_137 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_137
MWDSSRPRGIDFMNILYDEHLDGPLPKVDKQALLQALQAQIPDLDILHQEEDLKPYECDG
LSAYRTTPLLVALPRRVEQVQALLKLCHGLDVPVVARGAGTGLSGGALPLESGVLLVMAR
FNQILHIDPDARTARLQPGVRNLAISQAAAPFGLYYAPDPSSQIACSIGGNVAENAGGVH
CLKYGLTVHNLLKLEILTIEGERLTLGSEALDSPGLDLLALFTGSEGLLGVITEVTVKLL
PRPQVAKVLLASFDSVDKAGRAVADIIAAGIIPGGLEMMDNLAIRAAEDFIHAGYPVEAE
AILLCELDGVEADVHDDCERVRQVLEQAGATEVRQARDEAERLRFWAGRKNAFPAVGRLA
PDYYCMDGTIPRRALPEVLQRIASLGAEHGLRVANVFHAGDGNMHPLILFDANQPGELER
AETLGGKILELCVQVGGSITGEHGVGREKINQMCTQFNSDELNLFHAVKAAFDPQGLLNP
GKNIPTLHRCAEFGAMHIHGGQLPFPELERF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory