Comparing Pf6N2E2_1429 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1429 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
46% identity, 95% coverage: 7:247/253 of query aligns to 6:238/240 of 1ji0A
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 90% coverage: 7:234/253 of query aligns to 4:236/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 90% coverage: 7:234/253 of query aligns to 4:236/253 of 1g9xB
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
32% identity, 89% coverage: 24:247/253 of query aligns to 18:235/240 of 6mjpA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 85% coverage: 24:238/253 of query aligns to 17:226/240 of 4ymuJ
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
28% identity, 92% coverage: 6:238/253 of query aligns to 1:226/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
26% identity, 91% coverage: 8:238/253 of query aligns to 1:228/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
26% identity, 91% coverage: 8:238/253 of query aligns to 1:228/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
26% identity, 91% coverage: 8:238/253 of query aligns to 1:228/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
26% identity, 91% coverage: 8:238/253 of query aligns to 1:228/242 of 2oljA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
29% identity, 89% coverage: 24:247/253 of query aligns to 18:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
29% identity, 89% coverage: 24:247/253 of query aligns to 18:235/238 of 6s8gA
Sites not aligning to the query:
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
29% identity, 89% coverage: 24:247/253 of query aligns to 18:235/235 of 6mhzA
Sites not aligning to the query:
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
29% identity, 89% coverage: 7:231/253 of query aligns to 3:222/230 of 6z4wA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
29% identity, 89% coverage: 7:231/253 of query aligns to 3:222/229 of 6z67B
6mbnA Lptb e163q in complex with atp (see paper)
28% identity, 89% coverage: 24:247/253 of query aligns to 19:236/241 of 6mbnA
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
28% identity, 84% coverage: 18:229/253 of query aligns to 15:226/232 of 1f3oA
Sites not aligning to the query:
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
29% identity, 88% coverage: 24:246/253 of query aligns to 18:234/234 of 6b89A
Sites not aligning to the query:
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
29% identity, 88% coverage: 24:246/253 of query aligns to 18:234/234 of 4p31A
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
26% identity, 91% coverage: 7:235/253 of query aligns to 1:228/343 of P30750
Sites not aligning to the query:
>Pf6N2E2_1429 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1429
MATNVPILQIDDIEVLYEQTILAVRSVSLEVGKGQVVVLLGANGAGKSTTLKAASNLVRA
ERGEVVRGRIVYQGRDVTRSAPHTLAASGLVQVLEGRHCFAQLTVEENLLAGALARQVPR
RQLLADLESVYGHFPRLKLRRKSLAGYTSGGEQQMIAIGRALMAKPQLVLLDEPSMGLAP
QIVEEIFEIVRQLNQRDGVSFLIAEQNINIALRYAHHGYVLESGRVVSEGSAEQLAARGD
LQDFYLGARTAAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory