SitesBLAST
Comparing Pf6N2E2_1441 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1441 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q53TZ2 L-arabinose 1-dehydrogenase (NAD(P)(+)); D-galactose 1-dehydrogenase; EC 1.1.1.376; EC 1.1.1.120; EC 1.1.1.48 from Azospirillum brasilense (see paper)
51% identity, 98% coverage: 4:306/308 of query aligns to 5:307/309 of Q53TZ2
- D169 (= D168) mutation to A: Loss of activity.
- N173 (= N172) mutation to A: Decrease by 4 orders of magnitude in catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7cgqA Crystal structure of azospirillum brasilense l-arabinose 1- dehydrogenase e147a mutant (NADP and l-arabinose bound form)
51% identity, 98% coverage: 4:306/308 of query aligns to 2:304/306 of 7cgqA
- binding alpha-L-arabinopyranose: K88 (= K90), H116 (= H118), H150 (= H152), P167 (= P169), N170 (= N172)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G12), K11 (= K13), I12 (= I14), S34 (≠ T36), R35 (≠ Q37), H36 (≠ G38), C64 (= C66), A65 (≠ T67), P66 (= P68), V69 (≠ G71), E87 (= E89), K88 (= K90), H116 (= H118), Q153 (= Q155), W155 (= W157), D166 (= D168), Y263 (= Y265)
1zh8A Crystal structure of oxidoreductase (tm0312) from thermotoga maritima at 2.50 a resolution
30% identity, 44% coverage: 1:134/308 of query aligns to 1:142/325 of 1zh8A
- active site: K98 (= K90)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G10), C11 (≠ Y11), G12 (= G12), I13 (≠ K13), A14 (≠ I14), S37 (≠ T36), R38 (≠ Q37), T39 (≠ G38), H42 (≠ C41), T74 (≠ C66), L75 (≠ T67), P76 (= P68), L79 (≠ G71), E97 (= E89), K98 (= K90), N126 (≠ H118)
Sites not aligning to the query:
3m2tA The crystal structure of dehydrogenase from chromobacterium violaceum
30% identity, 41% coverage: 4:130/308 of query aligns to 4:137/342 of 3m2tA
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), G12 (= G12), A13 (≠ K13), Q14 (≠ I14), D36 (vs. gap), S37 (≠ T36), R41 (≠ P40), A73 (≠ C66), G74 (≠ T67), L78 (≠ G71), E96 (= E89), K97 (= K90), N125 (≠ H118)
Sites not aligning to the query:
7d5nA Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
31% identity, 58% coverage: 2:181/308 of query aligns to 9:208/379 of 7d5nA
- binding 1,4-dihydronicotinamide adenine dinucleotide: G17 (= G10), G19 (= G12), S22 (≠ A15), Q23 (= Q16), I24 (≠ D17), D46 (≠ Q37), I47 (≠ G38), T91 (= T67), P92 (= P68), N93 (≠ P69), H96 (≠ R72), E113 (= E89), K114 (= K90), W185 (= W159), R186 (≠ Q160), H199 (≠ N172)
Sites not aligning to the query:
3rc1A Crystal structure of kijd10, a 3-ketoreductase from actinomadura kijaniata incomplex with NADP and tdp-benzene (see paper)
34% identity, 36% coverage: 2:111/308 of query aligns to 1:116/325 of 3rc1A
- active site: K95 (= K90)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C10 (≠ Y11), A11 (≠ G12), D12 (≠ K13), I13 (= I14), S35 (≠ T36), R36 (≠ Q37), Y56 (≠ G57), P71 (≠ C66), L72 (≠ T67), P73 (= P68), H77 (≠ R72), E94 (= E89), K95 (= K90)
- binding 5'-O-[(S)-hydroxy{[(S)-hydroxy(phenoxy)phosphoryl]oxy}phosphoryl]thymidine: R16 (≠ D17), R17 (≠ Q18)
Sites not aligning to the query:
B3TMR8 dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase; 3-ketoreductase; NADPH-dependent C3-ketoreductase; EC 1.1.1.384 from Actinomadura kijaniata (see paper)
34% identity, 36% coverage: 2:111/308 of query aligns to 8:123/332 of B3TMR8
- 17:23 (vs. 11:17, 29% identical) binding
- SR 42:43 (≠ TQ 36:37) binding
- Y63 (≠ G57) binding
- L79 (≠ T67) binding
- H84 (≠ R72) binding
- K102 (= K90) active site, Proton donor; mutation K->A,M,Q: Loss of reductase activity.; mutation to E: Retains some activity, but the catalytic efficiency is strongly reduced.
Sites not aligning to the query:
- 170 binding
- 182 binding
- 186 Y→F: Same affinity for dTDP-glucose and NADPH compared to the wild-type. Small reduction of the catalytic efficiency resulting from the conformational flexibility of the nicotinamide ring.
7d5nB Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
35% identity, 38% coverage: 2:118/308 of query aligns to 9:146/389 of 7d5nB
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K114 (= K90), Y143 (≠ F115)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G17 (= G10), G19 (= G12), S22 (≠ A15), Q23 (= Q16), I24 (≠ D17), D46 (≠ Q37), I47 (≠ G38), T91 (= T67), P92 (= P68), N93 (≠ P69), H96 (≠ R72), E113 (= E89), K114 (= K90)
Sites not aligning to the query:
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: 190, 204, 208
- binding 1,4-dihydronicotinamide adenine dinucleotide: 189, 190, 208, 332
7d5mA Crystal structure of inositol dehydrogenase homolog complexed with NAD+ from azotobacter vinelandii
35% identity, 38% coverage: 2:118/308 of query aligns to 10:147/389 of 7d5mA
- binding nicotinamide-adenine-dinucleotide: G18 (= G10), G20 (= G12), S23 (≠ A15), Q24 (= Q16), I25 (≠ D17), D47 (≠ Q37), I48 (≠ G38), T92 (= T67), P93 (= P68), N94 (≠ P69), H97 (≠ R72), E114 (= E89), K115 (= K90)
Sites not aligning to the query:
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
33% identity, 42% coverage: 5:133/308 of query aligns to 2:136/332 of 2glxA
- active site: K93 (= K90)
- binding acetate ion: K93 (= K90)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G10), A8 (≠ Y11), S9 (≠ G12), T10 (≠ K13), I11 (= I14), S32 (≠ A35), T33 (= T36), R37 (≠ P40), S69 (≠ C66), T70 (= T67), N72 (≠ P69), H75 (≠ R72), E92 (= E89), K93 (= K90), H121 (= H118)
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
33% identity, 42% coverage: 5:133/308 of query aligns to 3:137/333 of Q2I8V6
- ASTI 9:12 (≠ YGKI 11:14) binding
- S10 (≠ G12) mutation to G: Almost no effect.
- A13 (= A15) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (≠ A35) mutation to D: No activity.
- ST 33:34 (≠ AT 35:36) binding
- R38 (≠ P40) binding
- TTNELH 71:76 (≠ TPPQGR 67:72) binding
- EK 93:94 (= EK 89:90) binding
- K94 (= K90) mutation to G: Less than 1% remaining activity.
- N120 (≠ A116) binding
Sites not aligning to the query:
- 162:163 binding
- 176 D→A: Less than 1% remaining activity.
- 180 H→A: Less than 2% remaining activity.
- 206 G→I: No effect.
- 283 binding
7xr9A Crystal structure of dgpa with glucose (see paper)
30% identity, 35% coverage: 15:121/308 of query aligns to 16:122/344 of 7xr9A
Sites not aligning to the query:
7x2yA Crystal structure of cis-4,5-dihydrodiol phthalate dehydrogenase in complex with NAD+ and 3-hydroxybenzoate (see paper)
30% identity, 45% coverage: 4:142/308 of query aligns to 4:147/342 of 7x2yA
- binding 3-hydroxybenzoic acid: H122 (≠ W117)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), G12 (= G12), R13 (≠ K13), A14 (= A15), D35 (≠ T36), P36 (vs. gap), R37 (≠ Q37), A71 (≠ C66), S72 (≠ T67), P73 (= P68), F76 (≠ G71), Q80 (≠ L75), E94 (= E89), K95 (= K90), P96 (= P91)
Sites not aligning to the query:
4nheB The crystal structure of oxidoreductase (gfo/idh/moca family) from streptococcus pneumoniae tigr4 in complex with NADP
23% identity, 48% coverage: 4:150/308 of query aligns to 3:154/326 of 4nheB
- active site: K94 (= K90)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: T10 (≠ Y11), I13 (= I14), S34 (vs. gap), R35 (vs. gap), T39 (vs. gap), A70 (≠ C66), S71 (≠ T67), P72 (= P68), N73 (≠ P69), H76 (≠ R72), E93 (= E89), K94 (= K90), R122 (≠ H118)
Sites not aligning to the query:
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
22% identity, 62% coverage: 8:197/308 of query aligns to 36:243/381 of 1rydA
- active site: K129 (= K90), Y217 (≠ N172)
- binding alpha-D-glucopyranose: Y236 (≠ A190)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L39 (≠ Y11), G40 (= G12), K41 (= K13), Y42 (≠ I14), S64 (≠ H24), G65 (≠ A25), K69 (≠ F29), Y87 (≠ F47), L106 (≠ T67), P107 (= P68), N108 (≠ P69), L110 (≠ G71), H111 (≠ R72), E128 (= E89), K129 (= K90), R157 (≠ H118), A196 (≠ G154), W199 (= W157), R200 (≠ I158), Y217 (≠ N172)
Sites not aligning to the query:
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
26% identity, 47% coverage: 46:191/308 of query aligns to 58:206/336 of 5a06A
- active site: K101 (= K90), Y186 (≠ N172)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y59 (≠ F47), I77 (≠ C66), T78 (= T67), P79 (= P68), N80 (≠ P69), L82 (≠ G71), H83 (≠ R72), E100 (= E89), K101 (= K90), R129 (≠ H118), W168 (= W151), R169 (≠ H152), Y186 (≠ N172)
- binding sorbitol: D72 (= D61), H96 (= H85), K101 (= K90), R122 (≠ V111), R122 (≠ V111), L124 (≠ G113), F160 (≠ D143), R169 (≠ H152), D182 (= D168), Y186 (≠ N172)
Sites not aligning to the query:
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 11, 12, 13, 14, 36, 37, 38, 41, 264
- binding sorbitol: 2, 287, 296, 299, 306, 310, 311
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
26% identity, 47% coverage: 46:191/308 of query aligns to 58:206/336 of 5a03C
- active site: K101 (= K90), Y186 (≠ N172)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y59 (≠ F47), I77 (≠ C66), T78 (= T67), P79 (= P68), N80 (≠ P69), L82 (≠ G71), H83 (≠ R72), E100 (= E89), K101 (= K90), R129 (≠ H118), W168 (= W151), R169 (≠ H152), Y186 (≠ N172)
- binding beta-D-xylopyranose: K101 (= K90), F160 (≠ D143), R169 (≠ H152), D182 (= D168), Y186 (≠ N172)
Sites not aligning to the query:
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
26% identity, 47% coverage: 46:191/308 of query aligns to 57:205/335 of 5a05A
- active site: K100 (= K90), Y185 (≠ N172)
- binding beta-D-glucopyranose: K100 (= K90), F159 (≠ D143), D181 (= D168), Y185 (≠ N172)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y58 (≠ F47), I76 (≠ C66), T77 (= T67), P78 (= P68), N79 (≠ P69), L81 (≠ G71), H82 (≠ R72), E99 (= E89), K100 (= K90), R128 (≠ H118), W167 (= W151), R168 (≠ H152), Y185 (≠ N172)
Sites not aligning to the query:
- binding alpha-D-glucopyranose: 259, 262
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 9, 10, 11, 12, 13, 35, 36, 37, 40, 263
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
26% identity, 47% coverage: 46:191/308 of query aligns to 57:205/335 of 5a04A
- active site: K100 (= K90), Y185 (≠ N172)
- binding beta-D-glucopyranose: K100 (= K90), F159 (≠ D143), R168 (≠ H152), D181 (= D168), Y185 (≠ N172)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y58 (≠ F47), I76 (≠ C66), T77 (= T67), P78 (= P68), N79 (≠ P69), L81 (≠ G71), H82 (≠ R72), E99 (= E89), K100 (= K90), R128 (≠ H118), W167 (= W151), R168 (≠ H152), Y185 (≠ N172)
Sites not aligning to the query:
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
26% identity, 47% coverage: 46:191/308 of query aligns to 57:205/335 of 5a03E
- active site: K100 (= K90), Y185 (≠ N172)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y58 (≠ F47), I76 (≠ C66), T77 (= T67), P78 (= P68), N79 (≠ P69), H82 (≠ R72), E99 (= E89), K100 (= K90), R128 (≠ H118), W167 (= W151), R168 (≠ H152), Y185 (≠ N172)
- binding beta-D-xylopyranose: K100 (= K90), F159 (≠ D143), R168 (≠ H152), D181 (= D168), Y185 (≠ N172), E205 (= E191)
- binding alpha-D-xylopyranose: H134 (vs. gap)
Sites not aligning to the query:
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 9, 10, 11, 12, 13, 35, 36, 37, 40, 263
- binding beta-D-xylopyranose: 207, 209
- binding alpha-D-xylopyranose: 268, 279, 280
Query Sequence
>Pf6N2E2_1441 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1441
MQPIRLGLVGYGKIAQDQHVPAIHANPAFQLVAVATQGQPCAGVENFRSLGELLENGPQV
DAIAFCTPPQGRFALVQQALAAGKHVLVEKPPCATLGEAMALVEQVREQGVSGLFAWHSR
YAPGIAAARDWLASRTLHSVQIDWKEDVRKWHPGQAWIWQPGGLGVFDPGINALSIATHL
LALPLFVEAAELRVPDNCQSPIAASIKMADARHLDIRAEFDFDHGHDELWSIEIRCAEGV
LRLDNGGALLSIDGVRQAVSEEGEYAAVYRHFQQLINDKASDMDLQPLRLVADSFFVGSR
TAVEPFYD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory