Comparing Pf6N2E2_1443 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1443 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
34% identity, 96% coverage: 1:323/335 of query aligns to 1:310/333 of 1pz1A
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
34% identity, 96% coverage: 1:323/335 of query aligns to 1:310/331 of P80874
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
32% identity, 93% coverage: 1:312/335 of query aligns to 1:310/326 of P77256
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
33% identity, 94% coverage: 1:316/335 of query aligns to 1:302/310 of P46336
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
33% identity, 94% coverage: 2:316/335 of query aligns to 1:301/311 of 1pz0A
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
28% identity, 97% coverage: 1:325/335 of query aligns to 1:311/337 of Q3L181
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
32% identity, 95% coverage: 1:317/335 of query aligns to 2:269/275 of 6kiyA
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
32% identity, 95% coverage: 1:317/335 of query aligns to 2:269/275 of 6kikA
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
32% identity, 95% coverage: 1:317/335 of query aligns to 1:268/274 of 5danA
1lqaA Tas protein from escherichia coli in complex with NADPH (see paper)
30% identity, 95% coverage: 1:319/335 of query aligns to 1:334/346 of 1lqaA
P0A9T4 Protein tas from Escherichia coli (strain K12) (see paper)
30% identity, 95% coverage: 1:319/335 of query aligns to 1:334/346 of P0A9T4
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
26% identity, 99% coverage: 1:332/335 of query aligns to 1:286/287 of 3v0sA
8hw0A The structure of akr6d1
30% identity, 91% coverage: 1:305/335 of query aligns to 1:299/329 of 8hw0A
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
29% identity, 96% coverage: 1:323/335 of query aligns to 1:292/301 of 6ow0B
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
28% identity, 95% coverage: 1:319/335 of query aligns to 1:312/323 of 6ow0A
Q9P7U2 Putative aryl-alcohol dehydrogenase C977.14c; EC 1.1.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 96% coverage: 6:325/335 of query aligns to 12:345/351 of Q9P7U2
Q13303 Voltage-gated potassium channel subunit beta-2; K(+) channel subunit beta-2; Kv-beta-2; hKvbeta2; EC 1.1.1.- from Homo sapiens (Human) (see 2 papers)
28% identity, 95% coverage: 6:323/335 of query aligns to 42:355/367 of Q13303
Sites not aligning to the query:
7wf3C Composite map of human kv1.3 channel in apo state with beta subunits (see paper)
28% identity, 95% coverage: 6:323/335 of query aligns to 9:322/328 of 7wf3C
P63144 Voltage-gated potassium channel subunit beta-1; K(+) channel subunit beta-1; Kv-beta-1; EC 1.1.1.- from Rattus norvegicus (Rat) (see paper)
27% identity, 96% coverage: 1:323/335 of query aligns to 71:389/401 of P63144
Q14722 Voltage-gated potassium channel subunit beta-1; K(+) channel subunit beta-1; Kv-beta-1; EC 1.1.1.- from Homo sapiens (Human) (see paper)
27% identity, 96% coverage: 1:323/335 of query aligns to 89:407/419 of Q14722
>Pf6N2E2_1443 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1443
MQKNRLGSSDLLISPIGLGTWAIAGTGWEYSWGAQDDEDSLGALEYAVECGVNWIDTAAI
YGLGHAEHLVGQLLRRLPASQRPLVFTKGSLVWDPVTKAISHSLAPQSLLAEVEASLRRL
QVETLDLYQIHWPAFPADGSSEGLEQALSALATAREQGKIRAIGVSNFDVAQLKRALAVT
EIVSLQPPYSVLMRDIEEDVLPFCEHTGMGVLAYSTLQSGLLSGSMTRQRIAQLPDDDWR
KARSADFQEPRLSANLALVEVLAGIGERHGVSAAAVAIAWVLRKPVVTGAIVGARCRGQV
DGLIAGAQLRLSAEEIEEIRPFLPLGMGTNVPRSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory