Comparing Pf6N2E2_1484 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1484 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
2i3gA Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (rv1652) from mycobacterium tuberculosis in complex with NADP+. (see paper)
31% identity, 70% coverage: 90:306/309 of query aligns to 127:332/347 of 2i3gA
Sites not aligning to the query:
7npjB Crystal structure of mycobacterium tuberculosis argc in complex with 6-phenoxy-3-pyridinamine
31% identity, 70% coverage: 90:306/309 of query aligns to 124:329/344 of 7npjB
Sites not aligning to the query:
7nphC Crystal structure of mycobacterium tuberculosis argc in complex with 5-methoxy-1,3-benzoxazole-2-carboxylic acid
31% identity, 70% coverage: 90:306/309 of query aligns to 124:329/344 of 7nphC
Sites not aligning to the query:
7notA Crystal structure of mycobacterium tuberculosis argc in complex with nicotinamide adenine dinucleotide phosphate (NADP+) and 5-methoxy-3- indoleacetic acid
31% identity, 70% coverage: 90:306/309 of query aligns to 124:329/344 of 7notA
7nnrA Crystal structure of mycobacterium tuberculosis argc in complex with xanthene-9-carboxylic acid
31% identity, 70% coverage: 90:306/309 of query aligns to 124:329/344 of 7nnrA
Sites not aligning to the query:
2ozpA Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (ttha1904) from thermus thermophilus
23% identity, 93% coverage: 19:306/309 of query aligns to 45:327/342 of 2ozpA
Sites not aligning to the query:
O50146 [LysW]-L-2-aminoadipate 6-phosphate reductase; EC 1.2.1.103 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
24% identity, 93% coverage: 19:306/309 of query aligns to 47:329/344 of O50146
Sites not aligning to the query:
P23247 Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see paper)
24% identity, 75% coverage: 74:306/309 of query aligns to 89:333/337 of P23247
2r00C Crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae (see paper)
24% identity, 75% coverage: 74:306/309 of query aligns to 88:332/336 of 2r00C
Sites not aligning to the query:
>Pf6N2E2_1484 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1484
MASPLVFIDGDQGTTGLQIHQRLRERNDLRLFTLSPEHRKDPQRRAEAINHCDIAVLCLP
DQAARDAVATIENSAVRVIDASSAHRTQPDWAYGFAEMNPQQAQRIAAARRVSNPGCYPT
GAIGLLRPLLEAGLLPRDYPLNIHAVSGYSGKGRVGVQEHEGAGAAQASAFQVYGLGLAH
KHVPEIQQQSGLTQCPMFVPAYGAFRQGIVLTIPLHTRLLAPGVSAVQLHGCLMQHYADA
RHVQVMSMQEAKALTSLDPQALNGTDDLRLSVFDNDEAGQVLLAAVFDNLGKGAAGAAVQ
NLNLMLAGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory