Comparing Pf6N2E2_1491 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1491 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1yt8A Crystal structure of thiosulfate sulfurtransferase from pseudomonas aeruginosa
44% identity, 53% coverage: 24:512/921 of query aligns to 23:516/525 of 1yt8A
2gqnA Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-nitro-benzamide (see paper)
41% identity, 42% coverage: 531:913/921 of query aligns to 1:389/391 of 2gqnA
2fq6A Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-trifluoromethyl-benzamide (see paper)
41% identity, 42% coverage: 531:913/921 of query aligns to 1:389/391 of 2fq6A
1cl2A Cystathionine beta-lyase (cbl) from escherichia coli in complex with aminoethoxyvinylglycine (see paper)
41% identity, 42% coverage: 531:913/921 of query aligns to 1:389/391 of 1cl2A
1cl1B Cystathionine beta-lyase (cbl) from escherichia coli (see paper)
41% identity, 42% coverage: 531:913/921 of query aligns to 2:390/392 of 1cl1B
P06721 Cystathionine beta-lyase MetC; CBL; CL; Beta-cystathionase MetC; Cysteine desulfhydrase MetC; CD; Cysteine lyase MetC; Cysteine-S-conjugate beta-lyase MetC; EC 4.4.1.13; EC 4.4.1.28 from Escherichia coli (strain K12) (see 2 papers)
41% identity, 42% coverage: 531:913/921 of query aligns to 5:393/395 of P06721
8sadA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp/malonate complex (c2 form)
42% identity, 42% coverage: 531:913/921 of query aligns to 8:396/398 of 8sadA
8sabA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp adduct with alanine (c2 form)
42% identity, 42% coverage: 531:913/921 of query aligns to 2:390/392 of 8sabA
8u99A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-serine adduct)
42% identity, 42% coverage: 531:913/921 of query aligns to 1:389/391 of 8u99A
8u98A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-glycine adduct)
42% identity, 42% coverage: 531:913/921 of query aligns to 1:389/391 of 8u98A
8sa9A Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp-oxamate adduct (c2 form)
42% identity, 42% coverage: 531:913/921 of query aligns to 1:389/391 of 8sa9A
4itxA P113s mutant of e. Coli cystathionine beta-lyase metc inhibited by reaction with l-ala-p (see paper)
41% identity, 42% coverage: 531:913/921 of query aligns to 1:389/391 of 4itxA
4l0oH Structure determination of cystathionine gamma-synthase from helicobacter pylori
37% identity, 42% coverage: 531:913/921 of query aligns to 2:372/373 of 4l0oH
7d7oB Crystal structure of cystathionine gamma-lyase from bacillus cereus atcc 14579 (see paper)
33% identity, 41% coverage: 531:912/921 of query aligns to 2:377/377 of 7d7oB
8j6nA Crystal structure of cystathionine gamma-lyase in complex with compound 1 (see paper)
34% identity, 41% coverage: 534:914/921 of query aligns to 11:388/390 of 8j6nA
7mcyH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl3 (see paper)
32% identity, 41% coverage: 533:911/921 of query aligns to 4:377/380 of 7mcyH
Sites not aligning to the query:
7mcuH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl2 (see paper)
32% identity, 41% coverage: 533:911/921 of query aligns to 4:377/380 of 7mcuH
Sites not aligning to the query:
7mctH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl1 (see paper)
32% identity, 41% coverage: 533:911/921 of query aligns to 4:377/380 of 7mctH
Sites not aligning to the query:
7mcqA Crystal structure of staphylococcus aureus cystathionine gamma lyase, aoaa-bound enzyme in dimeric form (see paper)
32% identity, 41% coverage: 533:911/921 of query aligns to 4:377/380 of 7mcqA
7mcbH Crystal structure of staphylococcus aureus cystathionine gamma lyase holoenzyme (see paper)
32% identity, 41% coverage: 533:911/921 of query aligns to 4:377/380 of 7mcbH
Sites not aligning to the query:
>Pf6N2E2_1491 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1491
MSQTLTPQQLQQWLFDGQEIALFDVREHGQYGEAHLFFGVNLPYSRLELEARRLAPNLRV
RLVLHDQDGAGLAARAAQRLQALGYANVHILEGGADGWQAAGYQLFAGVHVPSKAFGEQV
EAVRHTPHVSARQLAQWQARGEPLVILDGRPLEEYRKMTIPGSICCPNGELGYRVHDLVP
DEQTPIVVNCAGRTRSIIGAQTLIDLGLKNPIYALENGTQGWHLEDLQLEHGSERRYADQ
VSSSTLPGQRLAATRLAERAGVPTVEATQVEQWAADAGRSLFLCDVRTAEEFAAGTLPGA
QHTPGGQLIQSTDLYVGVRQARVVLFDNDGVRAPIIASWLRQLGHEAFVLSGGLSSGLAL
PVPATVASEELPLISVLVLADALKDDAVALIDLRSSRAFRKGHIVGARWSIRPLLARALA
GEQRPLVLVADDPRLAALAALELPHAEVRLLDGGPDAWRSAGLALQEGADTLPDAQCIDF
LFFTHDRHAGNKDAARQYLAWEIGLLAQMSEEEVASLKPLQEQPQSTVAGRLRTRLVHGA
RTEKGTGARAVNVPVSRLSTVLFDNLAQMRDARSRRDSERVLSYGARGNPTAFALEDLVT
ELEGGYRTRLFGTGLAAVAQTFLTYLRPGDHVLITDAVYAPVRRVARDFLEAFGIQVGYF
APDGSDLPGRLQANTKMVYTEVPGSLLYELCDLPAIAALCKPRGILLAVDNTWGSGVLYR
PLTLGADISIMALTKYLSGHSDVLMGSVCTRQEAWPALAAMSDTFGNTVSPDDAYLVLRG
ARTLMPRLDTHERQALEVARWLQAQPQVKRVFHPALPEHPRHALWQRDFKGSNGLLSFEL
RENDDAYLERFIDALQVFGLGASWGGFESLVTVADTKDRQSAEDRALNPVVRLHVGLEDV
DVLVEDLRRGFAKAAASASMT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory