SitesBLAST
Comparing Pf6N2E2_1562 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1562 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
36% identity, 92% coverage: 16:309/318 of query aligns to 21:316/494 of 1tdjA
- active site: K58 (= K53), A83 (≠ R79), E209 (≠ V204), S213 (≠ A208), C215 (≠ A210), G237 (= G232), L310 (= L303), S311 (= S304)
- binding pyridoxal-5'-phosphate: F57 (= F52), K58 (= K53), N85 (= N81), G184 (= G179), G185 (≠ C180), G186 (= G181), G187 (≠ S182), G237 (= G232), E282 (= E277), S311 (= S304), G312 (= G305)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
36% identity, 92% coverage: 16:309/318 of query aligns to 25:320/514 of P04968
- K62 (= K53) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N81) binding
- GGGGL 188:192 (≠ GCGSG 179:183) binding
- S315 (= S304) binding
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
30% identity, 99% coverage: 5:318/318 of query aligns to 5:318/319 of 2zr8A
- active site: K53 (= K53), S78 (≠ R79), E204 (≠ V204), G208 (≠ A208), D210 (≠ A210), G232 (= G232), I303 (≠ L303), S304 (= S304)
- binding magnesium ion: E204 (≠ V204), G208 (≠ A208), D210 (≠ A210)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F52), K53 (= K53), S77 (≠ T78), S78 (≠ R79), N80 (= N81), H81 (= H82), P147 (= P148), G179 (= G179), G180 (≠ C180), G181 (= G181), G182 (≠ S182), G232 (= G232), E277 (= E277), T279 (≠ A279), S304 (= S304)
- binding serine: S78 (≠ R79), R129 (≠ A130), D231 (= D231), G232 (= G232), A233 (≠ L233), Q234 (≠ A234), T235 (≠ V235)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
30% identity, 99% coverage: 5:318/318 of query aligns to 5:318/319 of 2zpuA
- active site: K53 (= K53), S78 (≠ R79), E204 (≠ V204), G208 (≠ A208), D210 (≠ A210), G232 (= G232), I303 (≠ L303), S304 (= S304)
- binding magnesium ion: E204 (≠ V204), G208 (≠ A208), D210 (≠ A210)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F52), K53 (= K53), S77 (≠ T78), S78 (≠ R79), N80 (= N81), H81 (= H82), P147 (= P148), G179 (= G179), G180 (≠ C180), G181 (= G181), G182 (≠ S182), G232 (= G232), E277 (= E277), T279 (≠ A279), S304 (= S304)
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
30% identity, 98% coverage: 5:317/318 of query aligns to 4:316/318 of 1wtcA
- active site: K52 (= K53), S77 (≠ R79), E203 (≠ V204), G207 (≠ A208), D209 (≠ A210), G231 (= G232), I302 (≠ L303), S303 (= S304)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ P21), K47 (≠ P48), M48 (≠ T49), A109 (≠ N111), A110 (= A112), Y114 (≠ F116)
- binding magnesium ion: E203 (≠ V204), G207 (≠ A208), D209 (≠ A210)
- binding pyridoxal-5'-phosphate: F51 (= F52), K52 (= K53), N79 (= N81), G178 (= G179), G179 (≠ C180), G180 (= G181), G181 (≠ S182), G231 (= G232), E276 (= E277), T278 (≠ A279), S303 (= S304)
1v71A Crystal structure of s.Pombe serine racemase
30% identity, 98% coverage: 5:317/318 of query aligns to 4:316/318 of 1v71A
- active site: K52 (= K53), S77 (≠ R79), E203 (≠ V204), G207 (≠ A208), D209 (≠ A210), G231 (= G232), I302 (≠ L303), S303 (= S304)
- binding magnesium ion: E203 (≠ V204), G207 (≠ A208), D209 (≠ A210)
- binding pyridoxal-5'-phosphate: F51 (= F52), K52 (= K53), N79 (= N81), G178 (= G179), G179 (≠ C180), G180 (= G181), G181 (≠ S182), G231 (= G232), E276 (= E277), T278 (≠ A279), S303 (= S304), G304 (= G305)
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
30% identity, 99% coverage: 5:318/318 of query aligns to 9:322/323 of O59791
- S82 (≠ R79) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
32% identity, 100% coverage: 1:317/318 of query aligns to 1:317/319 of A4F2N8
- K53 (= K53) mutation to A: Loss of enzymatic activity.
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
30% identity, 98% coverage: 7:318/318 of query aligns to 10:323/326 of 2gn2A
- active site: K56 (= K53), A81 (≠ R79), Q207 (≠ V204), V211 (≠ A208), G213 (≠ A210), G235 (= G232), I308 (≠ L303), S309 (= S304)
- binding cytidine-5'-monophosphate: R51 (≠ P48), T52 (= T49), G53 (= G50), A114 (= A112), D117 (≠ G115), Y118 (≠ F116), N312 (= N307)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
30% identity, 95% coverage: 8:309/318 of query aligns to 8:310/310 of 7nbgDDD
- active site: K53 (= K53), S76 (≠ R79), E202 (≠ V204), A206 (= A208), D208 (≠ A210), G231 (= G232), L304 (= L303), S305 (= S304)
- binding calcium ion: E202 (≠ V204), A206 (= A208), D208 (≠ A210)
- binding magnesium ion: N239 (≠ E241)
- binding ortho-xylene: S76 (≠ R79), Q81 (= Q84), I96 (= I99), Y113 (≠ F116)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N78 (= N81), G177 (= G179), G178 (≠ C180), G179 (= G181), G180 (≠ S182), M181 (≠ G183), G231 (= G232), V232 (≠ L233), E275 (= E277), T277 (≠ G278), S305 (= S304), G306 (= G305)
Sites not aligning to the query:
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
30% identity, 95% coverage: 8:309/318 of query aligns to 9:311/322 of 3l6bA
- active site: K54 (= K53), S77 (≠ R79), E203 (≠ V204), A207 (= A208), D209 (≠ A210), G232 (= G232), T278 (≠ G278), L305 (= L303), S306 (= S304)
- binding malonate ion: K54 (= K53), S76 (≠ T78), S77 (≠ R79), N79 (= N81), H80 (= H82), R128 (= R131), G232 (= G232)
- binding manganese (ii) ion: E203 (≠ V204), A207 (= A208), D209 (≠ A210)
- binding pyridoxal-5'-phosphate: F53 (= F52), K54 (= K53), N79 (= N81), G178 (= G179), G179 (≠ C180), G180 (= G181), G181 (≠ S182), M182 (≠ G183), V233 (≠ L233), E276 (= E277), T278 (≠ G278), S306 (= S304), G307 (= G305)
6zspAAA serine racemase bound to atp and malonate. (see paper)
30% identity, 95% coverage: 8:309/318 of query aligns to 8:308/320 of 6zspAAA
- active site: K53 (= K53), S74 (≠ R79), E200 (≠ V204), A204 (= A208), D206 (≠ A210), G229 (= G232), L302 (= L303), S303 (= S304)
- binding adenosine-5'-triphosphate: S28 (≠ W28), S29 (≠ P29), I30 (≠ L30), K48 (≠ P48), T49 (= T49), Q79 (= Q84), Y111 (≠ F116), E266 (≠ T270), R267 (≠ D271), K269 (≠ H273), N306 (= N307)
- binding magnesium ion: E200 (≠ V204), A204 (= A208), D206 (≠ A210)
- binding malonate ion: K53 (= K53), S73 (≠ T78), S74 (≠ R79), N76 (= N81), H77 (= H82), R125 (= R131), G229 (= G232), S232 (≠ V235)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
30% identity, 95% coverage: 8:309/318 of query aligns to 8:315/320 of 7nbhAAA
- active site: K53 (= K53), S81 (≠ R79), E207 (≠ V204), A211 (= A208), D213 (≠ A210), G236 (= G232), L309 (= L303), S310 (= S304)
- binding calcium ion: E207 (≠ V204), A211 (= A208), D213 (≠ A210)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ R79), G85 (= G83), Q86 (= Q84), K111 (= K109), I115 (≠ M113), Y118 (≠ F116), D235 (= D231), P281 (vs. gap), N313 (= N307), V314 (≠ I308), D315 (= D309)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
30% identity, 95% coverage: 8:309/318 of query aligns to 8:315/323 of 7nbfAAA
- active site: K53 (= K53), S81 (≠ R79), E207 (≠ V204), A211 (= A208), D213 (≠ A210), G236 (= G232), L309 (= L303), S310 (= S304)
- binding calcium ion: E207 (≠ V204), A211 (= A208), D213 (≠ A210)
- binding magnesium ion: N244 (≠ E241)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N83 (= N81), G182 (= G179), G183 (≠ C180), G184 (= G181), G185 (≠ S182), M186 (≠ G183), G236 (= G232), V237 (≠ L233), T282 (≠ G278), S310 (= S304), G311 (= G305)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (≠ P21), L22 (≠ A22), T23 (= T23), P24 (≠ A24), L26 (≠ Y26), T27 (≠ A27), F46 (≠ H46)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
30% identity, 95% coverage: 8:309/318 of query aligns to 8:315/323 of 7nbdAAA
- active site: K53 (= K53), S81 (≠ R79), E207 (≠ V204), A211 (= A208), D213 (≠ A210), G236 (= G232), L309 (= L303), S310 (= S304)
- binding calcium ion: E207 (≠ V204), A211 (= A208), D213 (≠ A210)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ Y269), L278 (= L275), V314 (≠ I308)
- binding magnesium ion: N244 (≠ E241)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N83 (= N81), G182 (= G179), G183 (≠ C180), G184 (= G181), G185 (≠ S182), M186 (≠ G183), G236 (= G232), V237 (≠ L233), E280 (= E277), T282 (≠ G278), S310 (= S304), G311 (= G305)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
30% identity, 95% coverage: 8:309/318 of query aligns to 8:315/323 of 7nbcCCC
- active site: K53 (= K53), S81 (≠ R79), E207 (≠ V204), A211 (= A208), D213 (≠ A210), G236 (= G232), L309 (= L303), S310 (= S304)
- binding biphenyl-4-ylacetic acid: T78 (= T76), H79 (≠ A77), H84 (= H82), V148 (≠ L145), H149 (≠ V146), P150 (= P147)
- binding calcium ion: E207 (≠ V204), A211 (= A208), D213 (≠ A210)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N83 (= N81), G182 (= G179), G183 (≠ C180), G184 (= G181), G185 (≠ S182), M186 (≠ G183), G236 (= G232), V237 (≠ L233), T282 (≠ G278), S310 (= S304), G311 (= G305)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
30% identity, 95% coverage: 8:309/318 of query aligns to 8:315/323 of 7nbcAAA
- active site: K53 (= K53), S81 (≠ R79), E207 (≠ V204), A211 (= A208), D213 (≠ A210), G236 (= G232), L309 (= L303), S310 (= S304)
- binding calcium ion: E207 (≠ V204), A211 (= A208), D213 (≠ A210)
- binding magnesium ion: N244 (≠ E241)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N83 (= N81), G182 (= G179), G183 (≠ C180), G184 (= G181), G185 (≠ S182), M186 (≠ G183), G236 (= G232), V237 (≠ L233), T282 (≠ G278), S310 (= S304), G311 (= G305)
Sites not aligning to the query:
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
30% identity, 95% coverage: 8:309/318 of query aligns to 8:315/322 of 7nbgAAA
- active site: K53 (= K53), S81 (≠ R79), E207 (≠ V204), A211 (= A208), D213 (≠ A210), G236 (= G232), L309 (= L303), S310 (= S304)
- binding calcium ion: E207 (≠ V204), A211 (= A208), D213 (≠ A210)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N83 (= N81), G182 (= G179), G183 (≠ C180), G184 (= G181), G185 (≠ S182), M186 (≠ G183), G236 (= G232), V237 (≠ L233), T282 (≠ G278), S310 (= S304), G311 (= G305)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ R79), G85 (= G83), Q86 (= Q84), I101 (= I99), K111 (= K109), I115 (≠ M113), Y118 (≠ F116)
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
30% identity, 86% coverage: 35:309/318 of query aligns to 50:328/339 of Q7XSN8
- E219 (≠ V204) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ A210) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
Q9QZX7 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Mus musculus (Mouse) (see paper)
30% identity, 95% coverage: 8:309/318 of query aligns to 11:318/339 of Q9QZX7
- C113 (≠ E108) modified: S-nitrosocysteine; mutation to S: Abolishes S-nitrosylation.
Query Sequence
>Pf6N2E2_1562 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1562
MHTLTRDDIEQAARHLYEVMPATAQYAWPLLAERLGCTVWVKHENHTPTGAFKVRGGLTF
VRWLKREHPEAKGIVTATRGNHGQSLALAASALGLKALIVVPQGNSVEKNNAMRGFGGEV
VEYGRDFDEAREEAVRLAQSHGLYLVPPFHPELVKGVATYGLELFNAVPDLDTVYVPIGC
GSGICAVIAARDALGLKTQVVGVVSTEALAAKLSFEAGRLCETASANTFADGLAVRRPVP
EAFAIYGAGAARIVAVSDAEIAGAMRAYYTDTHNLAEGAGAAALAALMQERETMRGKRVA
VILSGGNIDRPVYANLIG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory