SitesBLAST
Comparing Pf6N2E2_1564 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1564 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9KNV2 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
34% identity, 48% coverage: 312:610/624 of query aligns to 68:360/361 of Q9KNV2
Sites not aligning to the query:
3zokA Structure of 3-dehydroquinate synthase from actinidia chinensis in complex with NAD (see paper)
34% identity, 50% coverage: 243:552/624 of query aligns to 13:310/365 of 3zokA
- active site: R122 (= R363), K144 (= K385), E186 (= E427), K228 (≠ L470), E238 (= E481), R242 (≠ G485), N246 (≠ D489), H249 (= H492), H253 (= H496), H266 (= H508)
- binding glycine: K144 (= K385), K228 (≠ L470), R242 (≠ G485)
- binding nicotinamide-adenine-dinucleotide: T44 (≠ Q280), V45 (≠ L281), D73 (≠ A314), E75 (= E316), K78 (= K319), G106 (= G347), G107 (= G348), V108 (≠ A349), D111 (= D352), T131 (≠ S372), T132 (= T373), M134 (≠ L375), D138 (= D379), S139 (≠ A380), K144 (= K385), K153 (= K394), T174 (≠ S415), L175 (= L416), E179 (≠ D420), H266 (= H508)
U3KRF2 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 from Actinidia chinensis var. chinensis (Chinese soft-hair kiwi) (see paper)
34% identity, 50% coverage: 243:552/624 of query aligns to 93:390/445 of U3KRF2
3okfA 2.5 angstrom resolution crystal structure of 3-dehydroquinate synthase (arob) from vibrio cholerae
34% identity, 48% coverage: 312:610/624 of query aligns to 69:359/360 of 3okfA
- active site: R120 (= R363), K142 (= K385), E184 (= E427), K226 (≠ H469), R238 (≠ G485), N242 (≠ D489), H245 (= H492), H249 (= H496), H262 (= H508)
- binding nicotinamide-adenine-dinucleotide: D71 (≠ A314), E73 (= E316), K76 (= K319), G104 (= G347), G105 (= G348), V106 (≠ A349), D109 (= D352), T129 (≠ S372), T130 (= T373), L132 (= L375), D136 (= D379), T172 (≠ S415), L173 (= L416), E177 (≠ D420)
Sites not aligning to the query:
5eksA Structure of 3-dehydroquinate synthase from acinetobacter baumannii in complex with NAD
35% identity, 47% coverage: 312:605/624 of query aligns to 69:349/355 of 5eksA
- active site: R120 (= R363), K142 (= K385), E184 (= E427), K226 (≠ L470), R237 (= R482), N241 (≠ D489), H244 (= H492), H248 (= H496), H261 (= H508)
- binding magnesium ion: E184 (= E427), H244 (= H492), H261 (= H508)
- binding nicotinamide-adenine-dinucleotide: D71 (≠ A314), E73 (= E316), K76 (= K319), G104 (= G347), G105 (= G348), V106 (≠ A349), D109 (= D352), T129 (≠ S372), T130 (= T373), D136 (= D379), S137 (≠ A380), K142 (= K385), T172 (≠ S415), L173 (= L416), E177 (≠ D420)
Sites not aligning to the query:
6llaB Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+ and NAD (see paper)
31% identity, 56% coverage: 254:605/624 of query aligns to 15:358/363 of 6llaB
- active site: R121 (= R363), K143 (= K385), E185 (= E427), K227 (≠ H469), E237 (≠ F480), R242 (≠ G485), N246 (≠ D489), H249 (= H492), H253 (= H496), H266 (= H508)
- binding magnesium ion: E185 (= E427), H249 (= H492), H266 (= H508)
- binding nicotinamide-adenine-dinucleotide: L46 (= L281), D72 (≠ A314), E74 (= E316), K77 (= K319), G105 (= G347), G106 (= G348), V107 (≠ A349), D110 (= D352), T130 (≠ S372), T131 (= T373), L133 (= L375), D137 (= D379), K143 (= K385), T173 (≠ S415), L174 (= L416), E178 (≠ D420)
6lk2A Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, NAD and chlorogenic acid (see paper)
31% identity, 56% coverage: 254:605/624 of query aligns to 15:354/357 of 6lk2A
- active site: R121 (= R363), K143 (= K385), E185 (= E427), K227 (≠ H469), R238 (≠ G485), N242 (≠ D489), H245 (= H492), H249 (= H496), H262 (= H508)
- binding (1R,3R,4S,5R)-3-[3-[3,4-bis(oxidanyl)phenyl]propanoyloxy]-1,4,5-tris(oxidanyl)cyclohexane-1-carboxylic acid: D137 (= D379), E185 (= E427), K227 (≠ H469), R238 (≠ G485), N242 (≠ D489), H245 (= H492), T246 (≠ W493), H249 (= H496), H262 (= H508)
- binding magnesium ion: E185 (= E427), H245 (= H492), H262 (= H508)
- binding nicotinamide-adenine-dinucleotide: L46 (= L281), D72 (≠ A314), E74 (= E316), K77 (= K319), G105 (= G347), G106 (= G348), V107 (≠ A349), D110 (= D352), T130 (≠ S372), T131 (= T373), L133 (= L375), D137 (= D379), S138 (≠ A380), C170 (≠ L412), T173 (≠ S415), L174 (= L416), P175 (≠ T417), E178 (≠ D420)
H2K887 2-epi-5-epi-valiolone synthase; EEVS; Sedoheptulose 7-phosphate cyclase; EC 4.2.3.152 from Streptomyces hygroscopicus subsp. jinggangensis (strain 5008) (see paper)
32% identity, 60% coverage: 238:611/624 of query aligns to 33:397/414 of H2K887
4p53A Vala (2-epi-5-epi-valiolone synthase) from streptomyces hygroscopicus subsp. Jinggangensis 5008 with NAD+ and zn2+ bound (see paper)
32% identity, 52% coverage: 290:611/624 of query aligns to 47:359/360 of 4p53A
- active site: R117 (= R363), K139 (= K385), E181 (= E427), M225 (≠ H469), E235 (= E481), R239 (≠ G485), D243 (= D489), H246 (= H492), P250 (≠ H496), H262 (= H508)
- binding 1,4-dihydronicotinamide adenine dinucleotide: E69 (= E316), K72 (= K319), G101 (= G347), G102 (= G348), V103 (≠ A349), D106 (= D352), T126 (≠ S372), T127 (= T373), I129 (≠ L375), D133 (= D379), A134 (= A380), K148 (= K394), T169 (≠ S415), L170 (= L416), H174 (≠ D420), H262 (= H508)
- binding zinc ion: E181 (= E427), H246 (= H492), H262 (= H508)
Sites not aligning to the query:
P56081 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
31% identity, 44% coverage: 286:561/624 of query aligns to 43:301/343 of P56081
1xagA Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, NAD+ and carbaphosphonate (see paper)
34% identity, 42% coverage: 288:549/624 of query aligns to 38:296/353 of 1xagA
- active site: R115 (= R363), K136 (= K385), E178 (= E427), K221 (≠ H469), E231 (= E481), R235 (≠ G485), N239 (≠ D489), H242 (= H492), H246 (= H496), H256 (= H508)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: K136 (= K385), N146 (= N395), E178 (= E427), K221 (≠ H469), R235 (≠ G485), L238 (= L488), N239 (≠ D489), H242 (= H492), H246 (= H496)
- binding nicotinamide-adenine-dinucleotide: D39 (≠ Q289), Y41 (≠ Q291), V42 (≠ I292), Y45 (= Y295), E68 (= E316), K71 (= K319), G99 (= G347), G100 (= G348), A101 (= A349), D104 (= D352), T124 (≠ S372), T125 (= T373), L127 (= L375), D130 (= D379), S131 (≠ A380), K136 (= K385), K145 (= K394), T166 (≠ S415), L167 (= L416), Q171 (≠ D420), H256 (= H508)
- binding zinc ion: E178 (= E427), H242 (= H492), H256 (= H508)
Sites not aligning to the query:
Q5NFS1 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
30% identity, 47% coverage: 315:605/624 of query aligns to 71:355/359 of Q5NFS1
Sites not aligning to the query:
3clhA Crystal structure of 3-dehydroquinate synthase (dhqs)from helicobacter pylori (see paper)
34% identity, 42% coverage: 286:544/624 of query aligns to 40:272/308 of 3clhA
- active site: R107 (= R363), K129 (= K385), E171 (= E427), K207 (≠ H469), R212 (≠ G475), N216 (≠ D489), H219 (= H492), H223 (= H496), H236 (= H508)
- binding nicotinamide-adenine-dinucleotide: S58 (≠ A314), E60 (= E316), K63 (= K319), G91 (= G347), G92 (= G348), V93 (≠ A349), D96 (= D352), T116 (≠ S372), T117 (= T373), L119 (= L375), D123 (= D379), A124 (= A380), K129 (= K385), N139 (= N395), T159 (≠ S415), L160 (= L416), E164 (≠ D420)
Sites not aligning to the query:
Q6GGU4 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Staphylococcus aureus (strain MRSA252) (see paper)
34% identity, 42% coverage: 288:549/624 of query aligns to 38:296/354 of Q6GGU4
P9WPX9 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
33% identity, 42% coverage: 290:549/624 of query aligns to 53:306/362 of P9WPX9
Sites not aligning to the query:
3qbeA Crystal structure of the 3-dehydroquinate synthase (arob) from mycobacterium tuberculosis
33% identity, 42% coverage: 290:549/624 of query aligns to 48:297/352 of 3qbeA
- active site: R117 (= R363), K139 (= K385), E181 (= E427), K223 (≠ H469), R233 (≠ F480), N237 (≠ D489), H240 (= H492), H244 (= H496), H256 (= H508)
- binding zinc ion: E181 (= E427), H240 (= H492), H256 (= H508)
3qbdA 3-dehydroquinate synthase (arob) from mycobacterium tuberculosis in complex with NAD
33% identity, 42% coverage: 290:549/624 of query aligns to 48:296/344 of 3qbdA
- active site: R117 (= R363), K139 (= K385), E181 (= E427), K223 (≠ C465), R232 (≠ T474), N236 (≠ D489), H239 (= H492), H243 (= H496), H255 (= H508)
- binding nicotinamide-adenine-dinucleotide: D68 (≠ A314), A69 (≠ G315), E70 (= E316), K73 (= K319), G101 (= G347), G102 (= G348), A103 (= A349), D106 (= D352), T126 (≠ S372), T127 (= T373), L129 (= L375), A134 (= A380), T169 (≠ S415), L170 (= L416)
Sites not aligning to the query:
5hvnA 3.0 angstrom crystal structure of 3-dehydroquinate synthase (arob) from francisella tularensis in complex with NAD.
33% identity, 38% coverage: 315:552/624 of query aligns to 74:307/354 of 5hvnA
- active site: R123 (= R363), K145 (= K385), E187 (= E427), K228 (≠ H469), R239 (≠ G485), N243 (≠ D489), H246 (= H492), H250 (= H496), H263 (= H508)
- binding nicotinamide-adenine-dinucleotide: E75 (= E316), K78 (= K319), G107 (= G347), G108 (= G348), V109 (≠ A349), D112 (= D352), T132 (≠ S372), T133 (= T373), L135 (= L375), D139 (= D379), K145 (= K385), F172 (≠ L412), T175 (≠ S415), L176 (= L416), E180 (≠ D420)
Sites not aligning to the query:
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
34% identity, 37% coverage: 311:541/624 of query aligns to 71:313/1555 of 6hqvA
- active site: R123 (= R363), K145 (= K385), E187 (= E427), K243 (vs. gap), E253 (= E481), R257 (≠ G485), N261 (≠ D489), H264 (= H492), H268 (= H496), H280 (= H508)
- binding glutamic acid: D139 (= D379), K145 (= K385), E187 (= E427), K243 (vs. gap), R257 (≠ G485), H264 (= H492), H280 (= H508)
- binding nicotinamide-adenine-dinucleotide: E76 (= E316), K79 (= K319), G107 (= G347), G108 (= G348), V109 (≠ A349), D112 (= D352), T132 (≠ S372), T133 (= T373), L135 (= L375), D139 (= D379), S140 (≠ A380), K145 (= K385), K154 (= K394), T175 (≠ S415), L176 (= L416), P177 (≠ T417), E180 (≠ D420), H280 (= H508)
- binding zinc ion: E187 (= E427), H264 (= H492), H280 (= H508)
Sites not aligning to the query:
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: 1060, 1062, 1181, 1224, 1232, 1242, 1243
- binding nicotinamide-adenine-dinucleotide: 42, 44, 45
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: 413, 562, 563, 874, 923, 924, 979, 1277, 1279, 1323, 1327, 1348, 1368, 1526
Q3M6C3 Demethyl-4-deoxygadusol synthase; DDGS; EC 4.2.3.154 from Trichormus variabilis (strain ATCC 29413 / PCC 7937) (Anabaena variabilis) (see paper)
29% identity, 60% coverage: 233:605/624 of query aligns to 17:378/410 of Q3M6C3
Query Sequence
>Pf6N2E2_1564 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1564
MKHGRGYRLLSQKGAAGHFWLSLVCFSALVIASFLLFEQQIQDFLTHLELYQPSTPAQKL
YLALLLIALLALDVVLPVPSSMVALLAVAMLGSVGGYLAIFVGLCLGAGLGYALGAGYLR
LLSGRLGLHQRQPGQLAYRLGTLSLICLRGVPVLAETSVVAAGMQGYPLRAFILVTTLAN
AGLALAYSAIGSFLVEQNALLVTLLASMVLPGLFIAGYSLFKSLRRSEAEQPLHGRFKVS
YDYPVVFTDHVFDPLNPCLHRQLMAGHRGPVTVLIFADEQLLHSAPHLQEQINAYFASHF
PDLHLQAPPIAVPAGESSKDSQVLQRLYTDMLKHGLDRHCHVLALGGGAVLDAVGYACAT
FHRGIRLIRIPSTVLAQNDAGIGVKNGINAFGQKNLLGAFYPATAVINDFQLLTSLTRRD
QIAGLAEAVKVALIKDPAFFQWMEQQADALAHFEHGASRYAIRRCAELHLAHITGAGDPF
ERGNGRPLDYGHWAAHKLENLSQHRLRHGEAVAVGMALDGLYANALGLLSDGDTERVLNL
LLKLGFCLNPPELTLKDALGRSQVLLGLEEFRQHLGGQLSIPMLSRIGESVDLHEIDTAR
MEQALQRLSTQVELAPILNERCAQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory