Comparing Pf6N2E2_161 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_161 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
39% identity, 85% coverage: 33:303/318 of query aligns to 1:270/287 of 5dteB
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
35% identity, 89% coverage: 37:318/318 of query aligns to 3:270/274 of 2ioyA
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
34% identity, 89% coverage: 34:315/318 of query aligns to 1:265/271 of 1dbpA
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
34% identity, 84% coverage: 37:303/318 of query aligns to 5:259/270 of 4zjpA
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
33% identity, 83% coverage: 38:301/318 of query aligns to 5:269/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
33% identity, 83% coverage: 38:301/318 of query aligns to 5:269/288 of 1gudA
Sites not aligning to the query:
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
33% identity, 83% coverage: 38:301/318 of query aligns to 5:269/288 of 8wlbA
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
33% identity, 83% coverage: 38:301/318 of query aligns to 5:269/288 of 8wl9A
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
28% identity, 89% coverage: 36:318/318 of query aligns to 2:277/290 of 4wutA
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
28% identity, 90% coverage: 34:318/318 of query aligns to 1:280/292 of 2fn8A
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
30% identity, 82% coverage: 37:297/318 of query aligns to 5:256/287 of 5ibqA
4ry0A Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
30% identity, 82% coverage: 37:297/318 of query aligns to 5:256/287 of 4ry0A
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
29% identity, 91% coverage: 30:318/318 of query aligns to 4:276/284 of 7e7mC
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
26% identity, 88% coverage: 37:317/318 of query aligns to 4:285/313 of 2h3hA
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
26% identity, 88% coverage: 37:317/318 of query aligns to 4:285/305 of 3c6qC
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
26% identity, 87% coverage: 31:306/318 of query aligns to 3:270/283 of 6gt9A
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
26% identity, 84% coverage: 39:306/318 of query aligns to 6:265/278 of 6guqA
2vk2A Crystal structure of a galactofuranose binding protein (see paper)
33% identity, 62% coverage: 82:278/318 of query aligns to 45:245/296 of 2vk2A
Sites not aligning to the query:
P39325 Galactofuranose-binding protein YtfQ from Escherichia coli (strain K12) (see 2 papers)
33% identity, 62% coverage: 82:278/318 of query aligns to 67:267/318 of P39325
Sites not aligning to the query:
4irxA Crystal structure of caulobacter myo-inositol binding protein bound to myo-inositol (see paper)
28% identity, 81% coverage: 36:294/318 of query aligns to 10:260/296 of 4irxA
>Pf6N2E2_161 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_161
MKLPFAGRLLAVAMLAAASAALPLSSAFAQTAEKPKVALVMKSLANEFFLTMEDGAKAYQ
KEHSADFDLISNGIKDETDTANQIRIVEQMIVSKVDALIIAPADSKAMVPVIKKAVDAGI
TVINIDNQLDPAVVKSKNINVPFVGPDNRKGARLVGEYLAKQLKAGDEVGIIEGVSTTTN
AQARTAGFKDAMEAAQVKVVSLQSGDWEINKGNQVAASMLSEYPNIKALLAGNDSMAVGA
VSAVRAAGKAGKVQVVGYDNINAIKPMLKDGRVLATADQFAAKQAVFGIETALKILKGEK
VDSGTNGVIETPVELVTK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory