SitesBLAST
Comparing Pf6N2E2_162 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_162 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
40% identity, 95% coverage: 8:497/517 of query aligns to 3:491/501 of P04983
- K43 (= K47) mutation to R: Loss of transport.
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
29% identity, 41% coverage: 9:221/517 of query aligns to 1:221/232 of 1f3oA
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 46% coverage: 9:248/517 of query aligns to 6:243/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 46% coverage: 9:248/517 of query aligns to 6:243/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 46% coverage: 9:248/517 of query aligns to 6:243/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
30% identity, 46% coverage: 9:248/517 of query aligns to 6:243/353 of Q97UY8
- S142 (≠ G147) mutation to A: Decrease in ATPase activity. Can form dimers.
- G144 (= G149) mutation to A: Loss of ATPase activity. Cannot form dimers. Forms an active heterodimer; when associated with A-166.
- E166 (= E171) mutation to A: Loss of ATPase activity. Can form dimers in the presence of ATP-Mg(2+). Forms an active heterodimer; when associated with A-144.; mutation to Q: Strong decrease in ATPase activity. Can form dimers in the presence of ATP alone, without Mg(2+).
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
28% identity, 41% coverage: 9:221/517 of query aligns to 1:221/230 of 1l2tA
- binding adenosine-5'-triphosphate: Y11 (= Y19), S40 (≠ N43), G41 (= G44), S42 (≠ A45), G43 (= G46), K44 (= K47), S45 (= S48), T46 (= T49), F138 (≠ D138), Q145 (≠ E145), S147 (≠ G147), G149 (= G149), Q150 (≠ H150), H204 (= H203)
7arlD Lolcde in complex with lipoprotein and adp (see paper)
33% identity, 39% coverage: 23:225/517 of query aligns to 21:222/222 of 7arlD
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
33% identity, 39% coverage: 23:225/517 of query aligns to 24:225/233 of P75957
- G42 (= G41) mutation to D: Loss of lipoprotein release when overexpressed.
7mdyC Lolcde nucleotide-bound
33% identity, 39% coverage: 23:225/517 of query aligns to 21:222/226 of 7mdyC
- binding adp orthovanadate: G42 (= G44), S43 (≠ A45), G44 (= G46), K45 (= K47), S46 (= S48), T47 (= T49), Q91 (= Q90), H138 (≠ T141), E142 (= E145), S144 (≠ G147), G145 (≠ I148), G146 (= G149), E168 (= E171), N172 (≠ M175), H201 (= H203)
- binding magnesium ion: S46 (= S48), Q91 (= Q90)
Sites not aligning to the query:
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
33% identity, 38% coverage: 23:221/517 of query aligns to 22:218/226 of 5xu1B
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
33% identity, 39% coverage: 23:225/517 of query aligns to 23:224/229 of 7v8iD
- binding phosphoaminophosphonic acid-adenylate ester: V23 (= V23), S43 (≠ N43), G44 (= G44), G46 (= G46), K47 (= K47), S48 (= S48), T49 (= T49), Q93 (= Q90), R137 (≠ D138), H140 (≠ T141), E144 (= E145), S146 (≠ G147), G148 (= G149), E149 (≠ H150), H203 (= H203)
- binding magnesium ion: S48 (= S48), Q93 (= Q90)
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
32% identity, 39% coverage: 23:225/517 of query aligns to 22:222/615 of 5lilA
- binding adenosine-5'-triphosphate: V22 (= V23), S42 (≠ N43), G43 (= G44), G45 (= G46), K46 (= K47), S47 (= S48), T48 (= T49), Q92 (= Q90), K136 (vs. gap), Q143 (≠ T141), S145 (≠ V143), G147 (= G149), Q148 (≠ H150)
- binding magnesium ion: S47 (= S48), Q92 (= Q90)
Sites not aligning to the query:
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
32% identity, 39% coverage: 23:225/517 of query aligns to 22:222/592 of 5lj7A
- binding adenosine-5'-triphosphate: V22 (= V23), S42 (≠ N43), G43 (= G44), G45 (= G46), K46 (= K47), S47 (= S48), T48 (= T49), Q92 (= Q90), K136 (vs. gap), Q143 (≠ T141), S145 (≠ V143), G147 (= G149), Q148 (≠ H150)
- binding magnesium ion: S47 (= S48), Q92 (= Q90)
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
34% identity, 46% coverage: 8:243/517 of query aligns to 1:234/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
34% identity, 46% coverage: 8:243/517 of query aligns to 1:234/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ Y19), S37 (≠ N43), G38 (= G44), C39 (≠ A45), G40 (= G46), K41 (= K47), S42 (= S48), T43 (= T49), Q81 (= Q90), R128 (≠ I137), A132 (≠ T141), S134 (≠ V143), G136 (= G149), Q137 (≠ H150), E158 (= E171), H191 (= H203)
- binding magnesium ion: S42 (= S48), Q81 (= Q90)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
34% identity, 46% coverage: 8:243/517 of query aligns to 1:234/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ Y19), G38 (= G44), C39 (≠ A45), G40 (= G46), K41 (= K47), S42 (= S48), T43 (= T49), R128 (≠ I137), S134 (≠ V143), Q137 (≠ H150)
- binding beryllium trifluoride ion: S37 (≠ N43), G38 (= G44), K41 (= K47), Q81 (= Q90), S134 (≠ V143), G136 (= G149), H191 (= H203)
- binding magnesium ion: S42 (= S48), Q81 (= Q90)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
34% identity, 46% coverage: 8:243/517 of query aligns to 1:234/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ Y19), V17 (≠ L24), G38 (= G44), C39 (≠ A45), G40 (= G46), K41 (= K47), S42 (= S48), T43 (= T49), R128 (≠ I137), A132 (≠ T141), S134 (≠ V143), Q137 (≠ H150)
- binding tetrafluoroaluminate ion: S37 (≠ N43), G38 (= G44), K41 (= K47), Q81 (= Q90), S134 (≠ V143), G135 (= G144), G136 (= G149), E158 (= E171), H191 (= H203)
- binding magnesium ion: S42 (= S48), Q81 (= Q90)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
34% identity, 46% coverage: 8:243/517 of query aligns to 1:234/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ Y19), V17 (≠ L24), G38 (= G44), C39 (≠ A45), G40 (= G46), K41 (= K47), S42 (= S48), T43 (= T49), R128 (≠ I137), A132 (≠ T141), S134 (≠ V143), Q137 (≠ H150)
- binding magnesium ion: S42 (= S48), Q81 (= Q90)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
34% identity, 46% coverage: 8:243/517 of query aligns to 2:235/371 of P68187
- A85 (≠ N93) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ G113) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ L121) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ A124) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (= E127) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ V132) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G149) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D170) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (≠ Q236) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
Sites not aligning to the query:
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
Query Sequence
>Pf6N2E2_162 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_162
MSVRDPNAVLCVSGIGKTYAQPVLTDINLTLMRGEVLALTGENGAGKSTLSKIIGGLVTP
TTGQMQFQGQDYRPGSRTQAEELGVRMVMQELNLLPTLSVAENLFLDNLPNHGGWISRKQ
LRKAAIEAMAQVGLDAIDPDTLVGELGIGHQQMVEIARNLIGDCHVLILDEPTAMLTARE
VEMLFEQITRLQARGVSIIYISHRLEELARVAQRIAVLRDGNLVCVEPMANYNSEQLVTL
MVGRELGEHIDLGPRQIGAPALTVKGLTRSDKVRDVSFEVRSGEIFGISGLIGAGRTELL
RLIFGADTADSGTVALGSPAQVVSIRSPADAVAHGIALITEDRKGEGLLLTQSIAANIAL
GNMPEISSAGLVNGDAELALAQRQVDAMRIRSSSPTQLVSELSGGNQQKVVIGRWLERDC
AVMLFDEPTRGIDVGAKFDIYALLGELTRQGKALVVVSSDLRELMLICDRIGVLSAGRLI
DTFERDSWTQDDLLAAAFAGYQKRDALLNEAAPRDFS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory