Comparing Pf6N2E2_1648 Maltose/maltodextrin ABC transporter, permease protein MalG to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
31% identity, 92% coverage: 23:280/280 of query aligns to 24:281/281 of P94530
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
36% identity, 74% coverage: 74:280/280 of query aligns to 87:296/296 of P68183
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
28% identity, 68% coverage: 7:197/280 of query aligns to 3:209/285 of 7cagA
Sites not aligning to the query:
>Pf6N2E2_1648 Maltose/maltodextrin ABC transporter, permease protein MalG
MSPRLLKKALLRAGFWCLIGILLLYAVFPFYYAIVTSLKPSSALFQVSYWIDNPDFSNYA
AVLGQASFLRAIGNSLVVALCVVALALLLSLTAAYALGRVKFRGRGVVLMMVLGVSMFPQ
VAVLSGLFEVIRALGLYNTSWALILSYTIFTLPFTVWVLTTFMGQLPHELEEAAIMDGAS
PWVTLTRVLLPLLWPALVTTGLLAFIAAWNEFLFALTFTLTDSQRTVPVAIALISGGSPH
ELPWGLLMAASVLVTVPLVILVLIFQRRIVSGLTAGALKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory