Comparing Pf6N2E2_1650 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1650 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7vcpA Frischella perrara beta-fructofuranosidase in complex with fructose (see paper)
44% identity, 97% coverage: 12:497/500 of query aligns to 3:487/490 of 7vcpA
7bwcA Bombyx mori gh32 beta-fructofuranosidase bmsuc1 mutant d63a in complex with sucrose (see paper)
37% identity, 91% coverage: 20:472/500 of query aligns to 10:440/464 of 7bwcA
3pijB Beta-fructofuranosidase from bifidobacterium longum - complex with fructose (see paper)
32% identity, 95% coverage: 14:487/500 of query aligns to 19:504/526 of 3pijB
6nunA Structure of gh32 hydrolase from bifidobacterium adolescentis in complex with frutose
33% identity, 89% coverage: 36:480/500 of query aligns to 39:495/516 of 6nunA
O33833 Beta-fructosidase; Invertase; Sucrase; EC 3.2.1.26 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
35% identity, 87% coverage: 34:469/500 of query aligns to 2:406/432 of O33833
1w2tB Beta-fructosidase from thermotoga maritima in complex with raffinose (see paper)
35% identity, 87% coverage: 34:469/500 of query aligns to 2:406/432 of 1w2tB
1w2tA Beta-fructosidase from thermotoga maritima in complex with raffinose (see paper)
35% identity, 87% coverage: 34:469/500 of query aligns to 2:406/432 of 1w2tA
6nu8A Structure of sucrose-6-phosphate hydrolase from lactobacillus gasseri in complex with fructose
29% identity, 92% coverage: 19:478/500 of query aligns to 16:471/488 of 6nu8A
2aeyA Crystal structure of fructan 1-exohydrolase iia from cichorium intybus in complex with 2,5 dideoxy-2,5-immino-d-mannitol (see paper)
30% identity, 93% coverage: 34:498/500 of query aligns to 6:530/537 of 2aeyA
2addA Crystal structure of fructan 1-exohydrolase iia from cichorium intybus in complex with sucrose (see paper)
30% identity, 93% coverage: 34:498/500 of query aligns to 6:530/537 of 2addA
Q39041 Acid beta-fructofuranosidase 4, vacuolar; At beta fruct4; AtBETAFRUCT4; Acid invertase 4; AI 4; Acid sucrose hydrolase 4; Vacuolar invertase 4; Inv-V4; VAC-INV 4; VI 4; EC 3.2.1.26 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
27% identity, 89% coverage: 35:479/500 of query aligns to 121:625/664 of Q39041
Sites not aligning to the query:
O94220 Extracellular endo-inulinase inu2; 2,1-beta-D-fructanfructanohydrolase; Inulase; EC 3.2.1.7 from Aspergillus ficuum (see 2 papers)
30% identity, 92% coverage: 24:482/500 of query aligns to 21:500/516 of O94220
3rwkX First crystal structure of an endo-inulinase, from aspergillus ficuum: structural analysis and comparison with other gh32 enzymes. (see paper)
30% identity, 90% coverage: 33:482/500 of query aligns to 4:477/493 of 3rwkX
3uggA Crystal structure of a 6-sst/6-sft from pachysandra terminalis in complex with 1-kestose (see paper)
28% identity, 93% coverage: 35:500/500 of query aligns to 13:520/524 of 3uggA
2ac1A Crystal structure of a cell-wall invertase from arabidopsis thaliana (see paper)
28% identity, 87% coverage: 34:470/500 of query aligns to 4:502/537 of 2ac1A
Q43866 Beta-fructofuranosidase, insoluble isoenzyme CWINV1; Cell wall beta-fructosidase 1; AtbetaFRUCT1; Cell wall invertase 1; AtcwINV1; Sucrose hydrolase 1; EC 3.2.1.26 from Arabidopsis thaliana (Mouse-ear cress) (see 5 papers)
28% identity, 87% coverage: 34:470/500 of query aligns to 51:549/584 of Q43866
Q96TU3 Extracellular exo-inulinase inuE; EC 3.2.1.80 from Aspergillus awamori (Black koji mold) (see 2 papers)
28% identity, 90% coverage: 34:482/500 of query aligns to 26:519/537 of Q96TU3
Sites not aligning to the query:
1y9gA Crystal structure of exo-inulinase from aspergillus awamori complexed with fructose (see paper)
28% identity, 90% coverage: 34:482/500 of query aligns to 7:500/517 of 1y9gA
2qquA Crystal structure of a cell-wall invertase (d239a) from arabidopsis thaliana in complex with sucrose (see paper)
28% identity, 87% coverage: 34:470/500 of query aligns to 4:502/535 of 2qquA
2oxbA Crystal structure of a cell-wall invertase (e203q) from arabidopsis thaliana in complex with sucrose (see paper)
28% identity, 87% coverage: 34:470/500 of query aligns to 4:502/537 of 2oxbA
>Pf6N2E2_1650 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1650
MTVSVNAMNAPMPSPLEHAQQALSEGQSRLIGDYRPAYHLAPVAGWMNDPNGVVFFRGEY
HVFYQHHPFDAKWGPMYWGHAKSTDLVHWQHLPLALAPGDDFDRHGCFSGSAVVCGDTLA
LIYTGHTWLGEVGDERFIRQVQCLATSDDGIRFVKHGAVIENAPQETIMHFRDPKVWRED
GYWYLIAGARLGDKPLLPLYRSTDLHTWDFLDYVSSGNEGDGYMWECPDLFRLNGCDVLL
YSPQGMKPEGYERLNKYQTGYRIGRLDSEWHFTGGPFIELDNGHDFYAAQTLETADGRRL
VWAWLDMWESPMPSQAHHWCGMLGLPRELELQGDRLGVFPARELTALRQAPLPSVAPWGE
SGSRWVPQVKGDRLEIHVHLDLLDCTEGHLGIALRCSTDEQEQTLLYYDASLQRLVLDRS
RSGAQVSGQRSVSIVPSQTQLHLRVFLDRSSIEVFEENGRFSFSSRLYPRPDSLGVKLLA
NGTGGRVAIPKAWPLDSGWL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory