SitesBLAST
Comparing Pf6N2E2_1663 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1663 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
D4A1J4 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Rattus norvegicus (Rat) (see paper)
55% identity, 99% coverage: 3:246/246 of query aligns to 4:245/245 of D4A1J4
- Y147 (= Y143) mutation to F: Loss of function.
Q8JZV9 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Mus musculus (Mouse) (see paper)
55% identity, 99% coverage: 3:246/246 of query aligns to 4:245/245 of Q8JZV9
- Y147 (= Y143) active site, Proton acceptor; mutation to F: Loss of function.
Q9BUT1 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Homo sapiens (Human) (see 4 papers)
56% identity, 99% coverage: 3:246/246 of query aligns to 4:245/245 of Q9BUT1
2ag5A Crystal structure of human dhrs6 (see paper)
56% identity, 99% coverage: 3:246/246 of query aligns to 4:245/246 of 2ag5A
- active site: S133 (= S129), Y147 (= Y143), K151 (= K147), R192 (≠ Q191)
- binding nicotinamide-adenine-dinucleotide: Q16 (= Q15), G17 (= G16), I18 (= I17), D37 (= D36), I38 (= I37), D58 (= D54), V59 (= V55), V81 (≠ C77), G83 (= G79), L104 (= L100), Y147 (= Y143), K151 (= K147), P177 (= P173), V180 (= V176), T182 (≠ S178), S184 (= S180)
- binding sulfate ion: R144 (= R140), R188 (= R184), F202 (= F203), R205 (= R206)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
36% identity, 100% coverage: 1:245/246 of query aligns to 3:253/255 of 5itvA
- active site: G18 (= G16), S141 (= S129), Y154 (= Y143), K158 (= K147)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (≠ A12), S17 (≠ Q15), G18 (= G16), I19 (= I17), D38 (= D36), I39 (= I37), T61 (≠ L53), I63 (≠ V55), N89 (≠ C77), G91 (= G79), T139 (≠ M127), S141 (= S129), Y154 (= Y143), K158 (= K147), P184 (= P173), G185 (= G174), I186 (≠ T175), I187 (≠ V176)
8y83A Crystal structure of a ketoreductase from sphingobacterium siyangense sy1 with co-enzyme
34% identity, 99% coverage: 3:245/246 of query aligns to 4:247/249 of 8y83A
- binding nicotinamide-adenine-dinucleotide: G13 (≠ A12), S16 (≠ Q15), G17 (= G16), I18 (= I17), D37 (= D36), I38 (= I37), A62 (≠ L53), D63 (= D54), S64 (≠ V55), N90 (≠ C77), M141 (= M127), Y156 (= Y143), K160 (= K147), P186 (= P173), G187 (= G174), Y188 (≠ T175), I189 (≠ V176), L193 (≠ S180)
4gh5A Crystal structure of s-2-hydroxypropyl coenzyme m dehydrogenase (s- hpcdh) (see paper)
42% identity, 78% coverage: 54:245/246 of query aligns to 68:246/248 of 4gh5A
- active site: N113 (= N101), S141 (= S129), Y154 (= Y143), K158 (= K147)
- binding nicotinamide-adenine-dinucleotide: N89 (≠ C77), A90 (= A78), V112 (≠ L100), F139 (≠ M127), S141 (= S129), Y154 (= Y143), K158 (= K147), P184 (= P173), V187 (= V176), T190 (≠ P179), G191 (≠ S180), M192 (≠ L181)
Sites not aligning to the query:
A7IQH5 2-(S)-hydroxypropyl-CoM dehydrogenase 3; S-HPCDH 3; 2-[(S)-2-hydroxypropylthio]ethanesulfonate dehydrogenase 3; Aliphatic epoxide carboxylation component IV; Epoxide carboxylase component IV; SHPCDH3; EC 1.1.1.269 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 2 papers)
41% identity, 78% coverage: 54:245/246 of query aligns to 70:253/255 of A7IQH5
- N91 (≠ C77) binding
- S143 (= S129) binding ; mutation to A: Retains very weak activity.
- Y156 (= Y143) binding ; mutation to A: Retains some activity but with more than 2200-fold decrease in catalytic efficiency.; mutation to F: Loss of activity.
- K160 (= K147) binding ; mutation to A: Loss of activity.
- T188 (= T175) binding
- VTSTG 189:193 (≠ VDSPS 176:180) binding
- R211 (≠ F203) mutation to A: Severely impaired in the oxidation of S-HPC or reduction of 2-KPC but largely unaffected in the oxidation and reduction of aliphatic alcohols and ketones.
- K214 (≠ R206) mutation to A: Severely impaired in the oxidation of S-HPC or reduction of 2-KPC but largely unaffected in the oxidation and reduction of aliphatic alcohols and ketones.
- Y215 (≠ Q207) binding
Sites not aligning to the query:
- 19 binding
- 38 binding
- 64:65 binding
4ituA Crystal structure of s-2-hydroxypropyl coenzyme m dehydrogenase (s- hpcdh) bound to s-hpc and nadh (see paper)
41% identity, 78% coverage: 54:245/246 of query aligns to 68:251/253 of 4ituA
- active site: N113 (= N101), S141 (= S129), Y154 (= Y143), K158 (= K147)
- binding 2-{[(2S)-2-hydroxypropyl]sulfanyl}ethanesulfonic acid: S141 (= S129), Y154 (= Y143), T186 (= T175), R209 (≠ F203), Y213 (≠ Q207)
- binding 1,4-dihydronicotinamide adenine dinucleotide: N89 (≠ C77), V112 (≠ L100), F139 (≠ M127), S141 (= S129), Y154 (= Y143), K158 (= K147), P184 (= P173), T186 (= T175), V187 (= V176), T190 (≠ P179), M192 (≠ L181)
Sites not aligning to the query:
2dtxA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with d-mannose (see paper)
34% identity, 100% coverage: 2:246/246 of query aligns to 4:247/255 of 2dtxA
2dteA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with nadh (see paper)
34% identity, 100% coverage: 2:246/246 of query aligns to 4:247/255 of 2dteA
- active site: G18 (= G16), S132 (= S129), Y145 (= Y143), S148 (= S146), K149 (= K147)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (≠ A12), S16 (≠ G14), M17 (≠ Q15), G18 (= G16), I19 (= I17), S38 (≠ D36), I39 (= I37), C52 (≠ A50), D53 (= D54), V54 (= V55), N80 (≠ C77), A81 (= A78), I130 (≠ M127), S132 (= S129), Y145 (= Y143), K149 (= K147), P174 (= P173), A175 (≠ G174), T176 (= T175), I177 (≠ V176), T179 (≠ S178), P180 (= P179), L181 (≠ S180), V182 (≠ L181)
5b4tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and a substrate d-3- hydroxybutyrate (see paper)
36% identity, 99% coverage: 3:245/246 of query aligns to 2:258/260 of 5b4tA
- active site: G15 (= G16), N114 (= N101), S142 (= S129), Y155 (= Y143), K159 (= K147), I200 (≠ Q188)
- binding (3R)-3-hydroxybutanoic acid: Q94 (≠ V81), S142 (= S129), H144 (≠ A131), K152 (≠ R140), Y155 (= Y143), W187 (≠ T175), Q196 (≠ R184)
- binding nicotinamide-adenine-dinucleotide: G11 (≠ A12), T13 (≠ G14), G15 (= G16), I16 (= I17), F36 (= F33), D63 (= D54), L64 (≠ V55), N90 (≠ C77), G92 (= G79), L113 (= L100), I140 (≠ M127), Y155 (= Y143), K159 (= K147), P185 (= P173), G186 (= G174), W187 (≠ T175), V188 (= V176), T190 (≠ S178), L192 (≠ S180), V193 (≠ L181)
3w8dA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and an inhibitor methylmalonate
36% identity, 99% coverage: 3:245/246 of query aligns to 2:258/260 of 3w8dA
- active site: G15 (= G16), N114 (= N101), S142 (= S129), Y155 (= Y143), K159 (= K147), I200 (≠ Q188)
- binding methylmalonic acid: Q94 (≠ V81), S142 (= S129), H144 (≠ A131), K152 (≠ R140), Y155 (= Y143), W187 (≠ T175), Q196 (≠ R184), W257 (≠ M244)
- binding nicotinamide-adenine-dinucleotide: G11 (≠ A12), T13 (≠ G14), S14 (≠ Q15), G15 (= G16), I16 (= I17), F36 (= F33), A62 (vs. gap), D63 (= D54), L64 (≠ V55), N90 (≠ C77), A91 (= A78), G92 (= G79), L113 (= L100), S142 (= S129), Y155 (= Y143), K159 (= K147), P185 (= P173), G186 (= G174), W187 (≠ T175), V188 (= V176), T190 (≠ S178), L192 (≠ S180), V193 (≠ L181)
3vdrA Crystal structure of d-3-hydroxybutyrate dehydrogenase, prepared in the presence of the substrate d-3-hydroxybutyrate and NAD(+) (see paper)
36% identity, 99% coverage: 3:245/246 of query aligns to 2:258/260 of 3vdrA
- active site: G15 (= G16), N114 (= N101), S142 (= S129), Y155 (= Y143), K159 (= K147), I200 (≠ Q188)
- binding (3R)-3-hydroxybutanoic acid: Q94 (≠ V81), H144 (≠ A131), K152 (≠ R140), Y155 (= Y143), W187 (≠ T175), Q196 (≠ R184), W257 (≠ M244)
- binding acetoacetic acid: Q94 (≠ V81), H144 (≠ A131), K152 (≠ R140), Y155 (= Y143), W187 (≠ T175), Q196 (≠ R184), W257 (≠ M244)
- binding nicotinamide-adenine-dinucleotide: G11 (≠ A12), T13 (≠ G14), I16 (= I17), F36 (= F33), D63 (= D54), L64 (≠ V55), N90 (≠ C77), A91 (= A78), G92 (= G79), L113 (= L100), K159 (= K147), G186 (= G174), V188 (= V176), T190 (≠ S178), L192 (≠ S180), V193 (≠ L181)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (≠ A12), T13 (≠ G14), I16 (= I17), F36 (= F33), D63 (= D54), L64 (≠ V55), N90 (≠ C77), A91 (= A78), G92 (= G79), L113 (= L100), S142 (= S129), Y155 (= Y143), K159 (= K147), G186 (= G174), V188 (= V176), T190 (≠ S178), L192 (≠ S180), V193 (≠ L181)
3vdqA Crystal structure of alcaligenes faecalis d-3-hydroxybutyrate dehydrogenase in complex with NAD(+) and acetate (see paper)
36% identity, 99% coverage: 3:245/246 of query aligns to 2:258/260 of 3vdqA
- active site: G15 (= G16), N114 (= N101), S142 (= S129), Y155 (= Y143), K159 (= K147), I200 (≠ Q188)
- binding acetate ion: Q94 (≠ V81), H144 (≠ A131), K152 (≠ R140), W187 (≠ T175), L192 (≠ S180), Q196 (≠ R184)
- binding nicotinamide-adenine-dinucleotide: G11 (≠ A12), S14 (≠ Q15), I16 (= I17), F36 (= F33), D63 (= D54), L64 (≠ V55), N90 (≠ C77), A91 (= A78), G92 (= G79), L113 (= L100), I140 (≠ M127), S142 (= S129), Y155 (= Y143), K159 (= K147), P185 (= P173), G186 (= G174), W187 (≠ T175), V188 (= V176), T190 (≠ S178), L192 (≠ S180), V193 (≠ L181)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
34% identity, 99% coverage: 3:245/246 of query aligns to 3:246/248 of 6ixmC
- active site: G16 (= G16), S142 (= S129), Y155 (= Y143), K159 (= K147)
- binding nicotinamide-adenine-dinucleotide: G12 (≠ A12), S15 (≠ Q15), G16 (= G16), I17 (= I17), D36 (= D36), I37 (= I37), A61 (≠ L53), D62 (= D54), T63 (≠ V55), N89 (≠ C77), A90 (= A78), M140 (= M127), S142 (= S129), Y155 (= Y143), K159 (= K147), P185 (= P173), A186 (≠ G174), Y187 (≠ T175), I188 (≠ V176), L192 (≠ S180)
2q2qD Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida (see paper)
37% identity, 98% coverage: 3:244/246 of query aligns to 2:252/255 of 2q2qD
- active site: G15 (= G16), S138 (= S129), Y151 (= Y143), K155 (= K147), R196 (≠ Q188)
- binding nicotinamide-adenine-dinucleotide: G11 (≠ A12), T13 (≠ G14), S14 (≠ Q15), G15 (= G16), I16 (= I17), F36 (≠ I37), D59 (= D54), L60 (≠ V55), N86 (≠ C77), G88 (= G79), L109 (= L100), I136 (≠ M127), S138 (= S129), Y151 (= Y143), K155 (= K147), P181 (= P173), G182 (= G174), W183 (≠ T175), V184 (= V176), T186 (≠ S178), L188 (≠ S180), V189 (≠ L181)
2cfcA Structural basis for stereo selectivity in the (r)- and (s)- hydroxypropylethane thiosulfonate dehydrogenases (see paper)
34% identity, 96% coverage: 9:245/246 of query aligns to 6:248/250 of 2cfcA
- active site: G13 (= G16), S142 (= S129), Y155 (= Y143), K159 (= K147)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (≠ V137), R152 (= R140), Y155 (= Y143), W195 (≠ Q183), R196 (= R184)
- binding nicotinamide-adenine-dinucleotide: G9 (≠ A12), S12 (≠ Q15), G13 (= G16), N14 (≠ I17), D33 (= D36), L34 (≠ I37), A59 (≠ L53), D60 (= D54), V61 (= V55), N87 (≠ C77), A88 (= A78), G89 (= G79), I140 (≠ M127), P185 (= P173), G186 (= G174), M187 (≠ T175), I188 (≠ V176), T190 (≠ S178), P191 (= P179), M192 (≠ S180), T193 (≠ L181)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
34% identity, 96% coverage: 9:245/246 of query aligns to 6:248/250 of Q56840
- SGN 12:14 (≠ QGI 15:17) binding
- D33 (= D36) binding
- DV 60:61 (= DV 54:55) binding
- N87 (≠ C77) binding
- S142 (= S129) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (= R140) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y143) mutation Y->E,F: Loss of activity.
- K159 (= K147) mutation to A: Loss of activity.
- R179 (= R167) mutation to A: Loss of activity.
- IETPM 188:192 (≠ VDSPS 176:180) binding
- WR 195:196 (≠ QR 183:184) binding
- R196 (= R184) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- R203 (≠ Y200) mutation to A: Slight decrease in catalytic efficiency.
- R209 (= R206) mutation to A: Does not affect catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
35% identity, 99% coverage: 1:244/246 of query aligns to 4:244/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (≠ A12), S17 (≠ G14), R18 (≠ Q15), I20 (= I17), T40 (vs. gap), N62 (≠ D54), V63 (= V55), N89 (≠ C77), A90 (= A78), I92 (≠ Y80), V139 (≠ M127), S141 (= S129), Y154 (= Y143), K158 (= K147), P184 (= P173), G185 (= G174), I187 (≠ V176), T189 (≠ S178), M191 (≠ L181)
Query Sequence
>Pf6N2E2_1663 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1663
MNLQNKRVLVTAAGQGIGLASAVAFARAGAEVFATDIDIQALAGIEGITAMPLDVTSPAA
ISAACERIGGLDVLFNCAGYVHSGNILQCDEAAWARSMDLNVTAMYRMIHAFLPGMLARG
GGSIINMSSVASSVKGVPNRFAYATSKAAVVGLTKAVAIDFVSQGIRCNAICPGTVDSPS
LRQRIADQAAQQGVDEAQVYRQFLDRQPMGRIGHTEEIAQLALYLGSDASAYTTGAIHII
DGGMSI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory