Comparing Pf6N2E2_1717 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1717 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7pi1DDD Aminodeoxychorismate synthase component 1
34% identity, 92% coverage: 34:482/489 of query aligns to 27:453/459 of 7pi1DDD
7bvdA Anthranilate synthase component i (trpe)[mycolicibacterium smegmatis]
39% identity, 72% coverage: 125:478/489 of query aligns to 118:486/499 of 7bvdA
Sites not aligning to the query:
A0QX93 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
39% identity, 72% coverage: 125:478/489 of query aligns to 139:511/524 of A0QX93
P28820 Aminodeoxychorismate synthase component 1; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 1; EC 2.6.1.85 from Bacillus subtilis (strain 168) (see paper)
35% identity, 92% coverage: 34:482/489 of query aligns to 29:460/470 of P28820
O94582 Probable anthranilate synthase component 1; Anthranilate synthase component I; EC 4.1.3.27 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
37% identity, 75% coverage: 120:486/489 of query aligns to 97:478/489 of O94582
Sites not aligning to the query:
5cwaA Structure of anthranilate synthase component i (trpe) from mycobacterium tuberculosis with inhibitor bound (see paper)
36% identity, 91% coverage: 34:478/489 of query aligns to 46:490/505 of 5cwaA
P32068 Anthranilate synthase alpha subunit 1, chloroplastic; Anthranilate synthase component 1-1; Anthranilate synthase component I-1; Protein A-METHYL TRYPTOPHAN RESISTANT 1; Protein JASMONATE-INDUCED DEFECTIVE LATERAL ROOT 1; Protein TRYPTOPHAN BIOSYNTHESIS 5; Protein WEAK ETHYLENE INSENSITIVE 2; EC 4.1.3.27 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 92% coverage: 38:489/489 of query aligns to 111:592/595 of P32068
Q94GF1 Anthranilate synthase alpha subunit 1, chloroplastic; OsASA1; EC 4.1.3.27 from Oryza sativa subsp. japonica (Rice) (see paper)
36% identity, 72% coverage: 129:482/489 of query aligns to 174:567/577 of Q94GF1
P05041 Aminodeoxychorismate synthase component 1; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 1; EC 2.6.1.85 from Escherichia coli (strain K12) (see 4 papers)
32% identity, 75% coverage: 115:482/489 of query aligns to 89:451/453 of P05041
Sites not aligning to the query:
1i1qA Structure of the cooperative allosteric anthranilate synthase from salmonella typhimurium (see paper)
34% identity, 78% coverage: 104:482/489 of query aligns to 116:506/512 of 1i1qA
Sites not aligning to the query:
P00898 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
34% identity, 78% coverage: 104:482/489 of query aligns to 120:510/520 of P00898
Sites not aligning to the query:
1k0eA The crystal structure of aminodeoxychorismate synthase from formate grown crystals (see paper)
31% identity, 75% coverage: 115:482/489 of query aligns to 87:435/437 of 1k0eA
Sites not aligning to the query:
1i7qA Anthranilate synthase from s. Marcescens (see paper)
34% identity, 78% coverage: 104:482/489 of query aligns to 117:507/517 of 1i7qA
1i7sA Anthranilate synthase from serratia marcescens in complex with its end product inhibitor l-tryptophan (see paper)
34% identity, 78% coverage: 104:482/489 of query aligns to 111:501/511 of 1i7sA
Sites not aligning to the query:
P00897 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Serratia marcescens (see paper)
39% identity, 53% coverage: 223:482/489 of query aligns to 242:509/519 of P00897
Sites not aligning to the query:
8hx8A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate (see paper)
34% identity, 54% coverage: 223:485/489 of query aligns to 409:673/673 of 8hx8A
Sites not aligning to the query:
8hx9A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae with chorismate (see paper)
34% identity, 53% coverage: 223:482/489 of query aligns to 370:631/632 of 8hx9A
Sites not aligning to the query:
1k0gA The crystal structure of aminodeoxychorismate synthase from phosphate grown crystals (see paper)
30% identity, 75% coverage: 115:482/489 of query aligns to 89:418/420 of 1k0gA
Sites not aligning to the query:
1k0gB The crystal structure of aminodeoxychorismate synthase from phosphate grown crystals (see paper)
29% identity, 75% coverage: 115:482/489 of query aligns to 89:415/415 of 1k0gB
Sites not aligning to the query:
2g5fA The structure of mbti from mycobacterium tuberculosis, the first enzyme in the synthesis of mycobactin, reveals it to be a salicylate synthase (see paper)
32% identity, 49% coverage: 222:459/489 of query aligns to 170:409/435 of 2g5fA
Sites not aligning to the query:
>Pf6N2E2_1717 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1717
VNKNLIGVNVLRREERRPTDALGIYANAREQLGRESVFILESLSGPSRDRRATIVGLEPL
FEVRIDEGQAQLRGCAALCEHLSASLRQAGMQVDPEHKIHLPDSEAAWNLLRAIQATFQP
ASNAPSSLAFFGYFSYDCVRLIERLPDLAKQTYDYPLIALSVYQTLVYFHSNGIVETLIN
NHDLWSPRTLEDYPFLSSTPASEALAPLPYPEGFEEERTVTPEQFVERVEVAMEHIRAGD
VYQIQLGHEIRIRSQVSPFDVYQNLRLRNPSPYMYLAHVGGIDLIGASPELFVRIKDDLI
EMRPIAGTVGKKPGVDPTQLVLELTRSEKERAEHLMLIDLCRNDIGRVCQAGSLEVDEFM
LVEEYSHLYHMVSNVRGLLRPGLDAFDVIKASFPAGTMSGAPKVRAMELIEGMESNRRGI
YAGALGLVGFDGSVNTALCIRSTVFDEGTYHLRASAGVVADSVPELEWKETLYKMGSVYR
AVTGQEIAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory