Comparing Pf6N2E2_1742 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1742 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
50% identity, 96% coverage: 10:453/463 of query aligns to 1:443/451 of 6g4fA
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
50% identity, 96% coverage: 10:453/463 of query aligns to 1:443/451 of 6g4eA
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
50% identity, 96% coverage: 10:453/463 of query aligns to 1:443/453 of 6g4dB
5ghgB Transaminase w58l with smba
50% identity, 95% coverage: 16:455/463 of query aligns to 8:427/433 of 5ghgB
D6R3B6 Vanillin aminotransferase; Putative aminotransferase; pAMT; EC 2.6.1.119 from Capsicum frutescens (Cayenne pepper) (Tabasco pepper) (see paper)
47% identity, 90% coverage: 35:452/463 of query aligns to 27:444/459 of D6R3B6
Q94CE5 Gamma-aminobutyrate transaminase POP2, mitochondrial; AtGABA-T; Gamma-aminobutyric acid aminotransferase 1; Protein HEXENAL RESPONSE 1; Protein POLLEN-PISTIL INCOMPATIBILITY 2; AtPOP2; EC 2.6.1.96 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
46% identity, 91% coverage: 35:455/463 of query aligns to 70:491/504 of Q94CE5
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
43% identity, 97% coverage: 9:456/463 of query aligns to 5:454/458 of 5kr3A
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
43% identity, 96% coverage: 11:456/463 of query aligns to 8:457/460 of 5kr6B
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
43% identity, 97% coverage: 9:458/463 of query aligns to 2:455/455 of 5kr5A
4grxC Structure of an omega-aminotransferase from paracoccus denitrificans (see paper)
41% identity, 94% coverage: 19:455/463 of query aligns to 10:444/449 of 4grxC
4e3qA Pmp-bound form of aminotransferase crystal structure from vibrio fluvialis (see paper)
41% identity, 94% coverage: 19:455/463 of query aligns to 13:447/452 of 4e3qA
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
41% identity, 97% coverage: 9:456/463 of query aligns to 4:455/459 of 5kquC
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
42% identity, 95% coverage: 16:456/463 of query aligns to 10:446/450 of 6gwiB
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
42% identity, 96% coverage: 9:453/463 of query aligns to 3:445/454 of 7ypmA
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
42% identity, 96% coverage: 9:453/463 of query aligns to 3:445/455 of 7ypnD
3gjuA Crystal structure of a putative aminotransferase (mll7127) from mesorhizobium loti maff303099 at 1.55 a resolution
39% identity, 96% coverage: 10:455/463 of query aligns to 7:456/458 of 3gjuA
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
40% identity, 96% coverage: 11:455/463 of query aligns to 7:446/448 of 6io1B
3fcrA Crystal structure of putative aminotransferase (yp_614685.1) from silicibacter sp. Tm1040 at 1.80 a resolution
37% identity, 96% coverage: 11:455/463 of query aligns to 7:456/458 of 3fcrA
7q9xAAA Probable aminotransferase
39% identity, 97% coverage: 5:453/463 of query aligns to 2:443/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
39% identity, 97% coverage: 5:453/463 of query aligns to 2:443/455 of 4a6tC
>Pf6N2E2_1742 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1742
MMQETTPPLTELARTDMRFHLHSQTNLRAHQQHGPLVIERGSGIYVTDEHGRDYIEGMSG
LWCAGLGFSNPRLVQAAQRQMAVLPYYHTFNHRVPNVVAQLAERIASLVPFEKPKVFFAC
SGSEANDSMVKLAWAYHRARGNDGKRKIIAHQKGFHGSTVMGASLSGLPNMHAAFGLPLE
NSVLHVQCPHFYRHGIEGESEAQFTERLLRDLEQRIEAEGADTIAAFISEPVMGAGGVIV
PPPGYFVGVQALLKKHDILFLADEIICGFGRTGRWFGHQTLGFTPDMMACAKSLSSGYQP
ISCVVVAENVYQVIEEQSQQLGGFGHGFTYSGHPVAAAVALETLTLYQEMHLPQRTEELG
RLLHQQLEPLLAHPLIGEVRGIGLVAGLELVVDKHTRAPFPREIAIGVQVERAAREQGLI
VRNMGDSIALAPPFIISAEEIVELVARLTRALDAVALANGLSL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory