SitesBLAST
Comparing Pf6N2E2_1747 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1747 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6vspB Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
36% identity, 100% coverage: 1:243/244 of query aligns to 9:251/252 of 6vspB
6vspA Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
36% identity, 100% coverage: 1:243/244 of query aligns to 7:249/251 of 6vspA
- active site: G16 (= G10), S138 (= S131), Y151 (= Y144)
- binding nicotinamide-adenine-dinucleotide: G12 (= G6), N15 (≠ Q9), G16 (= G10), M17 (≠ I11), D36 (≠ G30), W37 (≠ R31), W37 (≠ R31), A38 (≠ D32), I59 (≠ G51), D60 (= D52), V61 (= V53), N87 (= N80), A88 (= A81), G89 (= G82), V90 (≠ M83), V110 (= V103), T136 (≠ V129), S138 (= S131), Y151 (= Y144), K155 (= K148), P181 (= P173), S182 (≠ G174), L183 (≠ Q175), V184 (≠ I176), T186 (= T178), N187 (≠ R179), M188 (= M180), T189 (≠ M181)
6xewA Structure of serratia marcescens 2,3-butanediol dehydrogenase (see paper)
36% identity, 100% coverage: 1:243/244 of query aligns to 7:249/251 of 6xewA
- active site: G16 (= G10), S138 (= S131), Y151 (= Y144)
- binding r,3-hydroxybutan-2-one: S138 (= S131), S140 (≠ A133), Y151 (= Y144)
- binding s,3-hydroxybutan-2-one: S138 (= S131), Y151 (= Y144), S182 (≠ G174)
- binding nicotinamide-adenine-dinucleotide: G12 (= G6), N15 (≠ Q9), G16 (= G10), M17 (≠ I11), D36 (≠ G30), W37 (≠ R31), W37 (≠ R31), A38 (≠ D32), I59 (≠ G51), D60 (= D52), V61 (= V53), N87 (= N80), A88 (= A81), G89 (= G82), V110 (= V103), T136 (≠ V129), S138 (= S131), Y151 (= Y144), K155 (= K148), S182 (≠ G174), L183 (≠ Q175), V184 (≠ I176), T186 (= T178), N187 (≠ R179), M188 (= M180), T189 (≠ M181)
H9XP47 Meso-2,3-butanediol dehydrogenase; BDH; meso-2,3-BDH; (R,S)-butane-2,3-diol dehydrogenase; NAD(H)-dependent meso-2,3-BDH; SmBdh; EC 1.1.1.- from Serratia marcescens (see paper)
36% identity, 100% coverage: 1:243/244 of query aligns to 7:249/251 of H9XP47
- N15 (≠ Q9) binding
- M17 (≠ I11) binding
- D36 (≠ G30) binding
- D60 (= D52) binding
- V61 (= V53) binding
- N87 (= N80) binding
- S138 (= S131) binding ; binding
- V139 (≠ I132) mutation to Q: Retains 50% of activity with acetoin as substrate; when associated with A-247.
- S140 (≠ A133) binding
- Y151 (= Y144) binding ; binding ; binding
- K155 (= K148) binding
- V184 (≠ I176) binding
- T186 (= T178) binding
- R-DK 197:199 (≠ RLSA 190:193) mutation to SEAAGKPLGYGTET: Mimics longer alpha6 helix. Retains 3% of activity with acetoin as substrate.
- Q247 (≠ S241) mutation to A: Retains 10% of activity with acetoin as substrate. Retains 50% of activity with acetoin as substrate; when associated with Q-139.
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
37% identity, 95% coverage: 3:234/244 of query aligns to 12:243/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G6), S17 (≠ T8), R18 (≠ Q9), I20 (= I11), T40 (≠ R31), N62 (≠ D52), V63 (= V53), N89 (= N80), A90 (= A81), I92 (≠ M83), V139 (= V129), S141 (= S131), Y154 (= Y144), K158 (= K148), P184 (= P173), G185 (= G174), I187 (= I176), T189 (= T178), M191 (= M180)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
37% identity, 95% coverage: 3:234/244 of query aligns to 12:239/243 of 4i08A
- active site: G19 (= G10), N113 (= N104), S141 (= S131), Q151 (≠ L141), Y154 (= Y144), K158 (= K148)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G6), S17 (≠ T8), R18 (≠ Q9), I20 (= I11), T40 (≠ R31), N62 (≠ D52), V63 (= V53), N89 (= N80), A90 (= A81), G140 (≠ S130), S141 (= S131), Y154 (= Y144), K158 (= K148), P184 (= P173), G185 (= G174), T189 (= T178)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
37% identity, 95% coverage: 3:234/244 of query aligns to 10:237/241 of 5t2uA
- active site: G17 (= G10), T135 (≠ S131), T145 (≠ L141), Y148 (= Y144), K152 (= K148)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G6), G17 (= G10), R38 (= R31), D39 (= D32), R42 (≠ A35), D60 (= D52), L61 (≠ V53), N83 (= N80), A84 (= A81), Y87 (≠ S84), I133 (≠ V129), T135 (≠ S131), Y148 (= Y144), K152 (= K148), P178 (= P173), P180 (≠ Q175), T181 (≠ I176), T183 (= T178), T185 (≠ M180), T186 (≠ M181)
A7DY56 Tropinone reductase; EC 1.1.1.206; EC 1.1.1.236 from Cochlearia officinalis (Common scurvygrass) (see paper)
37% identity, 95% coverage: 3:234/244 of query aligns to 22:259/273 of A7DY56
- Y209 (≠ I184) mutation to S: Loss of tropinone or nortropinone reduction, but faster reduction of cyclohexanones.
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
33% identity, 95% coverage: 3:234/244 of query aligns to 9:240/244 of 6t62A
- active site: G16 (= G10), S138 (= S131), Y151 (= Y144)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G6), S14 (≠ T8), R15 (≠ Q9), A36 (≠ G30), T37 (≠ R31), L58 (≠ G51), D59 (= D52), V60 (= V53), N86 (= N80), A87 (= A81), G88 (= G82), I89 (≠ M83), I136 (≠ V129), S137 (= S130), S138 (= S131), Y151 (= Y144), K155 (= K148), P181 (= P173), G182 (= G174), I184 (= I176), M188 (= M180)
Q9ZW19 Tropinone reductase homolog At2g29360; EC 1.1.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 96% coverage: 3:236/244 of query aligns to 22:261/271 of Q9ZW19
- S209 (≠ I184) mutation to Y: Loss of activity with quinuclidinone and decreased activity with cyclohexanones.
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
33% identity, 95% coverage: 3:234/244 of query aligns to 9:240/244 of 6wprA
- active site: G16 (= G10), S138 (= S131), Y151 (= Y144)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G6), S14 (≠ T8), R15 (≠ Q9), T37 (≠ R31), L58 (≠ G51), D59 (= D52), V60 (= V53), N86 (= N80), A87 (= A81), G88 (= G82), I89 (≠ M83), I136 (≠ V129), Y151 (= Y144), K155 (= K148), P181 (= P173)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
33% identity, 96% coverage: 3:237/244 of query aligns to 11:254/255 of 5itvA
- active site: G18 (= G10), S141 (= S131), Y154 (= Y144), K158 (= K148)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G6), S17 (≠ Q9), G18 (= G10), I19 (= I11), D38 (≠ G30), I39 (≠ R31), T61 (≠ G51), I63 (≠ V53), N89 (= N80), G91 (= G82), T139 (≠ V129), S141 (= S131), Y154 (= Y144), K158 (= K148), P184 (= P173), G185 (= G174), I186 (≠ Q175), I187 (= I176)
4gh5A Crystal structure of s-2-hydroxypropyl coenzyme m dehydrogenase (s- hpcdh) (see paper)
37% identity, 88% coverage: 23:237/244 of query aligns to 29:247/248 of 4gh5A
- active site: N113 (= N104), S141 (= S131), Y154 (= Y144), K158 (= K148)
- binding nicotinamide-adenine-dinucleotide: D36 (≠ G30), L37 (≠ R31), A61 (≠ G51), D62 (= D52), V63 (= V53), N89 (= N80), A90 (= A81), V112 (= V103), F139 (≠ V129), S141 (= S131), Y154 (= Y144), K158 (= K148), P184 (= P173), V187 (≠ I176), T190 (≠ R179), G191 (≠ M180), M192 (= M181)
Sites not aligning to the query:
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
36% identity, 95% coverage: 3:234/244 of query aligns to 11:254/258 of 3ak4A
- active site: G18 (= G10), S141 (= S131), L151 (= L141), Y154 (= Y144), K158 (= K148), E199 (= E188)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ Q9), G18 (= G10), I19 (= I11), D38 (≠ G30), L39 (≠ R31), V60 (≠ G51), D61 (= D52), V62 (= V53), N88 (= N80), A89 (= A81), G90 (= G82), T139 (≠ V129), S141 (= S131), Y154 (= Y144), K158 (= K148), G185 (= G174), V187 (≠ I176), T189 (= T178), M191 (= M180)
5fffA Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and piperonal (see paper)
35% identity, 96% coverage: 3:236/244 of query aligns to 15:254/257 of 5fffA
- active site: K206 (≠ E188)
- binding 1,3-benzodioxole-5-carbaldehyde: Y100 (≠ S84), H158 (≠ L141)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G6), T20 (= T8), G22 (= G10), I23 (= I11), R43 (= R31), C67 (vs. gap), D68 (= D52), V69 (= V53), N96 (= N80), I146 (≠ V129), Y161 (= Y144), K165 (= K148), P191 (= P173), A193 (≠ Q175), I194 (= I176), T196 (= T178), G198 (≠ M180), T199 (≠ M181)
5ff9B Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and tyramine (see paper)
35% identity, 96% coverage: 3:236/244 of query aligns to 15:254/257 of 5ff9B
- active site: K206 (≠ E188)
- binding 4-(2-aminoethyl)phenol: Y100 (≠ S84), I155 (≠ E138), H158 (≠ L141)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G6), T20 (= T8), K21 (≠ Q9), I23 (= I11), S42 (≠ G30), R43 (= R31), C67 (vs. gap), D68 (= D52), V69 (= V53), N96 (= N80), I146 (≠ V129), S148 (= S131), Y161 (= Y144), K165 (= K148), P191 (= P173), A193 (≠ Q175), I194 (= I176), T196 (= T178), G198 (≠ M180), T199 (≠ M181)
A0A1A9TAK5 Noroxomaritidine/norcraugsodine reductase; NorRed; EC 1.1.1.- from Narcissus pseudonarcissus (Daffodil) (see paper)
35% identity, 96% coverage: 3:236/244 of query aligns to 15:254/257 of A0A1A9TAK5
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
37% identity, 95% coverage: 3:234/244 of query aligns to 16:250/254 of 4ag3A
- active site: G23 (= G10), S148 (= S131), Y161 (= Y144), K165 (= K148)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G6), S21 (≠ T8), R22 (≠ Q9), G23 (= G10), I24 (= I11), T44 (≠ R31), L68 (vs. gap), D69 (= D52), V70 (= V53), N96 (= N80), A97 (= A81), I146 (≠ V129), S148 (= S131), Y161 (= Y144), K165 (= K148), P191 (= P173), G192 (= G174), F193 (≠ Q175), I194 (= I176), T196 (= T178), M198 (= M180), T199 (≠ M181)
6y4dA Crystal structure of a short-chain dehydrogenase/reductase (sdr) from zephyranthes treatiae in complex with NADP+ (see paper)
38% identity, 96% coverage: 3:236/244 of query aligns to 15:254/257 of 6y4dA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G6), T20 (= T8), K21 (≠ Q9), I23 (= I11), R43 (= R31), C67 (vs. gap), D68 (= D52), I69 (≠ V53), N96 (= N80), G98 (= G82), V146 (= V129), S147 (= S130), S148 (= S131), Y161 (= Y144), K165 (= K148), G192 (= G174), I194 (= I176), T196 (= T178), S198 (≠ M180)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
35% identity, 96% coverage: 3:236/244 of query aligns to 10:247/249 of 4bmsF
- active site: S137 (= S131), H147 (≠ L141), Y150 (= Y144), K154 (= K148), Q195 (≠ E188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G6), N15 (≠ T8), S16 (≠ Q9), I18 (= I11), R38 (= R31), R39 (≠ D32), A59 (≠ G51), D60 (= D52), V61 (= V53), N87 (= N80), S88 (≠ A81), G89 (= G82), V110 (= V103), S137 (= S131), Y150 (= Y144), K154 (= K148), G181 (= G174), I183 (= I176), T185 (= T178), I187 (≠ M180)
Query Sequence
>Pf6N2E2_1747 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1747
MYIVTGGTQGIGAATVEKLASLGHPVVFTGRDQSAGTQLAASLPNCTFVAGDVSNEDECR
NVVATALQLGNGKLAGLVNNAGMSGRKAFIETTQQEWDTLFAVNTRSVFFYTKHALPGLI
AGRGAVVNVSSIAGKTGEQGLATYCASKAALLGLTQALALEYGGQVRFNAVCPGQIATRM
MDKIVNDEARLSALTARIPEGRLASAREVAEAICWLLSPGASYVNGTTLTVDGGETAGLL
SPES
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory