Comparing Pf6N2E2_1793 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1793 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
41% identity, 92% coverage: 25:307/308 of query aligns to 9:287/287 of 4yo7A
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
34% identity, 99% coverage: 1:306/308 of query aligns to 1:313/349 of A0QYB5
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
36% identity, 92% coverage: 24:306/308 of query aligns to 4:281/315 of 4rsmA
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
35% identity, 92% coverage: 24:306/308 of query aligns to 36:313/349 of A0QYB3
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
35% identity, 92% coverage: 24:306/308 of query aligns to 3:280/314 of 5hkoA
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
35% identity, 92% coverage: 24:306/308 of query aligns to 3:280/315 of 4rs3A
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
33% identity, 90% coverage: 25:300/308 of query aligns to 3:273/274 of 2ioyA
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
34% identity, 94% coverage: 16:303/308 of query aligns to 2:282/284 of 7e7mC
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
29% identity, 88% coverage: 25:295/308 of query aligns to 5:268/270 of 4zjpA
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
30% identity, 85% coverage: 24:286/308 of query aligns to 4:270/287 of 5dteB
8fxuA Thermoanaerobacter thermosaccharolyticum periplasmic glucose-binding protein glucose complex: badan conjugate attached at f17c (see paper)
32% identity, 90% coverage: 24:301/308 of query aligns to 5:307/310 of 8fxuA
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
29% identity, 88% coverage: 25:295/308 of query aligns to 4:268/271 of 1dbpA
5ocpA The periplasmic binding protein component of the arabinose abc transporter from shewanella sp. Ana-3 bound to alpha and beta-l- arabinofuranose
33% identity, 82% coverage: 25:277/308 of query aligns to 3:260/302 of 5ocpA
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
35% identity, 78% coverage: 44:282/308 of query aligns to 19:264/292 of 2fn8A
Sites not aligning to the query:
P0AEE5 D-galactose/methyl-galactoside binding periplasmic protein MglB; D-galactose-binding periplasmic protein; GBP; D-galactose/D-glucose-binding protein; GGBP from Escherichia coli (strain K12) (see 4 papers)
28% identity, 99% coverage: 1:305/308 of query aligns to 1:331/332 of P0AEE5
P23905 D-galactose/methyl-galactoside binding periplasmic protein MglB; D-galactose-binding periplasmic protein; GBP; D-galactose/D-glucose-binding protein; GGBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
28% identity, 99% coverage: 1:305/308 of query aligns to 1:331/332 of P23905
2gbpA Sugar and signal-transducer binding sites of the escherichia coli galactose chemoreceptor protein (see paper)
28% identity, 93% coverage: 21:305/308 of query aligns to 1:308/309 of 2gbpA
2qw1A Glucose/galactose binding protein bound to 3-o-methyl d-glucose (see paper)
28% identity, 92% coverage: 22:303/308 of query aligns to 1:305/305 of 2qw1A
1gcaA The 1.7 angstroms refined x-ray structure of the periplasmic glucose(slash)galactose receptor from salmonella typhimurium (see paper)
28% identity, 93% coverage: 21:305/308 of query aligns to 1:308/309 of 1gcaA
5kwsA Crystal structure of galactose binding protein from yersinia pestis in the complex with beta d glucose
27% identity, 92% coverage: 21:303/308 of query aligns to 1:306/307 of 5kwsA
>Pf6N2E2_1793 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1793
MRRCTLLFATLLLLFSQWAAADYRIGVSIARVDDNFMTYVRNGLAEAAKKENVQIQFEDA
QGDVVRQLNQVQGFINQKVDAVIVLPVDTSATANITRAAVEAKTPLVYVNRHPDERTLPK
GVVTVASNDIEAGHLQMRYLAEKLGGKGNLAIIMGDLAQNATHDRTEGVKQVLKDYPGIK
IVEQQSAEWQRNKGMDLTSNWLLAGSRFDAIVANNDEMAIGAAMALQQAGKTKGEVAIVG
IDGLPDGLAAIKRGMLVASVFQDPKAQATSAVQAALKMIKGEPVETDVWVPFQLIKPEQL
AVFEQHYK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory