Comparing Pf6N2E2_1812 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1812 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
35% identity, 95% coverage: 1:322/338 of query aligns to 1:323/330 of P0AAH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
37% identity, 88% coverage: 25:322/338 of query aligns to 20:308/310 of 4fwiB
Sites not aligning to the query:
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
37% identity, 88% coverage: 25:322/338 of query aligns to 21:319/326 of Q8RDH4
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
34% identity, 70% coverage: 25:262/338 of query aligns to 15:239/241 of 4u00A
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
34% identity, 69% coverage: 31:262/338 of query aligns to 22:247/253 of 7z15I
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
34% identity, 69% coverage: 31:262/338 of query aligns to 22:247/250 of 7z18I
Sites not aligning to the query:
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
34% identity, 69% coverage: 31:262/338 of query aligns to 22:247/250 of 7z16I
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
32% identity, 70% coverage: 25:262/338 of query aligns to 16:241/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
32% identity, 70% coverage: 25:262/338 of query aligns to 16:241/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
32% identity, 70% coverage: 25:262/338 of query aligns to 16:241/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
32% identity, 70% coverage: 25:262/338 of query aligns to 16:241/242 of 2oljA
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 70% coverage: 25:262/338 of query aligns to 14:239/240 of 4ymuJ
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
29% identity, 84% coverage: 27:309/338 of query aligns to 41:326/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
29% identity, 84% coverage: 27:309/338 of query aligns to 41:326/382 of 7aheC
7ahdC Opua (e190q) occluded (see paper)
30% identity, 68% coverage: 27:256/338 of query aligns to 41:260/260 of 7ahdC
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 70% coverage: 25:261/338 of query aligns to 18:243/343 of P30750
Sites not aligning to the query:
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
30% identity, 70% coverage: 25:260/338 of query aligns to 23:253/257 of P0AAH0
Sites not aligning to the query:
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
31% identity, 69% coverage: 22:253/338 of query aligns to 17:236/615 of 5lilA
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 70% coverage: 25:261/338 of query aligns to 19:244/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
32% identity, 70% coverage: 25:261/338 of query aligns to 19:244/344 of 3tuiC
Sites not aligning to the query:
>Pf6N2E2_1812 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1812
MALLHVENLRVDIPMGNSPTPDDMLHAVRGLDFEVERGEMLCIVGESGCGKSLTSLALMD
LLPRKARRTASRLTLDGIDMLGQSERRMCDLRGNRLAMIFQEPMTSLNPAYSIGDQLSEV
LTQHRKVSRKDALARAAQMLEKVGISNAAERLRQYPHQLSGGLRQRVIIAMALMCEPDLI
IADEPTTALDVTIQAQILRLIRDIQKELGLAVIFITHDLGLVARIADRVAVMYAGEIVET
APARQLFENPQHPYTRGLLASIPIPGRTKPGEALGSIPGLVPSLVGEQQGCAFRNRCAQA
ITACAQDIPEIEQDGHMARCLFAAPAPAPIRLQERARS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory