SitesBLAST
Comparing Pf6N2E2_1835 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1835 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
35% identity, 96% coverage: 2:195/203 of query aligns to 60:254/257 of 6slbAAA
- active site: Q64 (≠ G6), F69 (≠ M11), L80 (≠ M23), N84 (≠ H27), A108 (= A51), S111 (≠ G54), A130 (≠ P73), F131 (= F74), L136 (= L79), P138 (= P81), D139 (= D82), A224 (≠ Q165), G234 (≠ L175)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: A62 (= A4), Q64 (≠ G6), D65 (= D7), L66 (≠ I8), Y76 (≠ A19), A108 (= A51), F131 (= F74), D139 (= D82)
Sites not aligning to the query:
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
34% identity, 96% coverage: 2:195/203 of query aligns to 57:242/245 of 6slaAAA
- active site: Q61 (≠ G6), L68 (≠ M23), N72 (≠ H27), A96 (= A51), S99 (≠ G54), A118 (≠ P73), F119 (= F74), L124 (= L79), P126 (= P81), N127 (≠ D82), A212 (≠ Q165), G222 (≠ L175)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: A59 (= A4), Q61 (≠ G6), D62 (= D7), L63 (≠ I8), L68 (≠ M23), Y71 (≠ I26), A94 (= A49), G95 (= G50), A96 (= A51), F119 (= F74), I122 (≠ L77), L124 (= L79), N127 (≠ D82), F234 (= F187), K237 (= K190)
Sites not aligning to the query:
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
32% identity, 96% coverage: 2:196/203 of query aligns to 61:255/255 of 3q0jC
- active site: A65 (≠ G6), M70 (= M11), T80 (≠ M23), F84 (≠ H27), G108 (≠ A51), E111 (≠ G54), P130 (= P73), E131 (≠ F74), V136 (≠ L79), P138 (= P81), G139 (≠ D82), L224 (≠ Q165), F234 (≠ L175)
- binding acetoacetyl-coenzyme a: A63 (= A4), G64 (= G5), A65 (≠ G6), D66 (= D7), I67 (= I8), K68 (≠ A9), M70 (= M11), F84 (≠ H27), G107 (= G50), G108 (≠ A51), E111 (≠ G54), P130 (= P73), E131 (≠ F74), P138 (= P81), G139 (≠ D82), M140 (≠ W83)
Sites not aligning to the query:
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
32% identity, 96% coverage: 2:196/203 of query aligns to 61:255/255 of 3q0gC
- active site: A65 (≠ G6), M70 (= M11), T80 (≠ M23), F84 (≠ H27), G108 (≠ A51), E111 (≠ G54), P130 (= P73), E131 (≠ F74), V136 (≠ L79), P138 (= P81), G139 (≠ D82), L224 (≠ Q165), F234 (≠ L175)
- binding coenzyme a: A63 (= A4), I67 (= I8), K68 (≠ A9), Y104 (≠ I47), P130 (= P73), E131 (≠ F74), L134 (= L77)
Sites not aligning to the query:
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
32% identity, 96% coverage: 2:196/203 of query aligns to 60:254/256 of 3h81A
- active site: A64 (≠ G6), M69 (= M11), T79 (≠ M23), F83 (≠ H27), G107 (≠ A51), E110 (≠ G54), P129 (= P73), E130 (≠ F74), V135 (≠ L79), P137 (= P81), G138 (≠ D82), L223 (≠ Q165), F233 (≠ L175)
- binding calcium ion: F233 (≠ L175), Q238 (≠ F180)
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
29% identity, 96% coverage: 2:195/203 of query aligns to 64:257/260 of 2hw5C
- active site: A68 (≠ G6), M73 (= M11), S83 (≠ A19), L87 (≠ M23), G111 (≠ A51), E114 (≠ G54), P133 (= P73), E134 (≠ F74), T139 (≠ L79), P141 (= P81), G142 (≠ D82), K227 (≠ Q165), F237 (≠ L175)
- binding crotonyl coenzyme a: I70 (= I8), F109 (≠ A49)
Sites not aligning to the query:
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
29% identity, 96% coverage: 2:195/203 of query aligns to 64:255/258 of 1mj3A
- active site: A68 (≠ G6), M73 (= M11), S83 (≠ E21), L85 (≠ M23), G109 (≠ A51), E112 (≠ G54), P131 (= P73), E132 (≠ F74), T137 (≠ L79), P139 (= P81), G140 (≠ D82), K225 (≠ Q165), F235 (≠ L175)
- binding hexanoyl-coenzyme a: A66 (= A4), G67 (= G5), A68 (≠ G6), D69 (= D7), I70 (= I8), G109 (≠ A51), P131 (= P73), E132 (≠ F74), L135 (= L77), G140 (≠ D82)
Sites not aligning to the query:
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
29% identity, 96% coverage: 2:195/203 of query aligns to 63:251/254 of 2dubA
- active site: A67 (≠ G6), M72 (= M11), S82 (≠ E21), G105 (≠ A51), E108 (≠ G54), P127 (= P73), E128 (≠ F74), T133 (≠ L79), P135 (= P81), G136 (≠ D82), K221 (≠ Q165), F231 (≠ L175)
- binding octanoyl-coenzyme a: A65 (= A4), A67 (≠ G6), D68 (= D7), I69 (= I8), K70 (≠ A9), G105 (≠ A51), E108 (≠ G54), P127 (= P73), E128 (≠ F74), G136 (≠ D82), A137 (≠ W83)
Sites not aligning to the query:
6n97A Methylmalonyl-coa decarboxylase in complex with 2-sulfonate-propionyl- amino(dethia)-coa (see paper)
25% identity, 97% coverage: 1:196/203 of query aligns to 60:258/260 of 6n97A
- active site: H65 (≠ G6), L70 (≠ M11), G109 (≠ A51), E112 (≠ G54), P132 (≠ F74), V137 (≠ L79), Y139 (≠ P81), E227 (≠ Q165), Y237 (≠ L175)
- binding (2R)-sulfonatepropionyl-amino(dethia)-CoA: A63 (= A4), H65 (≠ G6), D66 (= D7), I67 (= I8), W107 (≠ A49), G108 (= G50), G109 (≠ A51), T131 (≠ P73), P132 (≠ F74), L135 (= L77), Y139 (≠ P81), F249 (= F187), K252 (= K190)
- binding (2S)-sulfonatepropionyl-amino(dethia)-CoA: A63 (= A4), H65 (≠ G6), D66 (= D7), I67 (= I8), W107 (≠ A49), G108 (= G50), G109 (≠ A51), T131 (≠ P73), P132 (≠ F74), L135 (= L77), Y139 (≠ P81), F249 (= F187), K252 (= K190)
Sites not aligning to the query:
6n96A Methylmalonyl-coa decarboxylase in complex with 2-sulfonate-propionyl- oxa(dethia)-coa (see paper)
25% identity, 97% coverage: 1:196/203 of query aligns to 60:258/260 of 6n96A
- active site: H65 (≠ G6), L70 (≠ M11), G109 (≠ A51), E112 (≠ G54), P132 (≠ F74), V137 (≠ L79), Y139 (≠ P81), E227 (≠ Q165), Y237 (≠ L175)
- binding (2~{S})-1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethoxy]-1-oxidanylidene-propane-2-sulfonic acid: A63 (= A4), H65 (≠ G6), D66 (= D7), I67 (= I8), H68 (≠ A9), W107 (≠ A49), G108 (= G50), G109 (≠ A51), T131 (≠ P73), P132 (≠ F74), L135 (= L77), V137 (≠ L79), Y139 (≠ P81), F249 (= F187), K252 (= K190)
- binding (2~{R})-1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethoxy]-1-oxidanylidene-propane-2-sulfonic acid: A63 (= A4), H65 (≠ G6), D66 (= D7), I67 (= I8), H68 (≠ A9), W107 (≠ A49), G108 (= G50), G109 (≠ A51), T131 (≠ P73), P132 (≠ F74), L135 (= L77), V137 (≠ L79), Y139 (≠ P81), F249 (= F187), K252 (= K190)
Sites not aligning to the query:
6n95A Methylmalonyl-coa decarboxylase in complex with 2-sulfonate-propionyl- coa (see paper)
25% identity, 97% coverage: 1:196/203 of query aligns to 60:258/260 of 6n95A
- active site: H65 (≠ G6), L70 (≠ M11), G109 (≠ A51), E112 (≠ G54), P132 (≠ F74), V137 (≠ L79), Y139 (≠ P81), E227 (≠ Q165), Y237 (≠ L175)
- binding (2R)-sulfonatepropionyl-CoA: A63 (= A4), H65 (≠ G6), D66 (= D7), I67 (= I8), H68 (≠ A9), W107 (≠ A49), G108 (= G50), G109 (≠ A51), T131 (≠ P73), P132 (≠ F74), L135 (= L77), Y139 (≠ P81), F249 (= F187), K252 (= K190)
- binding (2S)-sulfonatepropionyl-CoA: A63 (= A4), H65 (≠ G6), D66 (= D7), I67 (= I8), H68 (≠ A9), W107 (≠ A49), G108 (= G50), G109 (≠ A51), T131 (≠ P73), P132 (≠ F74), L135 (= L77), V137 (≠ L79), Y139 (≠ P81), F249 (= F187), K252 (= K190)
Sites not aligning to the query:
6n94A Methylmalonyl-coa decarboxylase in complex with 2-nitronate-propionyl- amino(dethia)-coa (see paper)
25% identity, 97% coverage: 1:196/203 of query aligns to 60:258/260 of 6n94A
- active site: H65 (≠ G6), L70 (≠ M11), G109 (≠ A51), E112 (≠ G54), P132 (≠ F74), V137 (≠ L79), Y139 (≠ P81), E227 (≠ Q165), Y237 (≠ L175)
- binding [1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylamino]-1-oxidanylidene-propan-2-ylidene]-bis(oxidanidyl)azanium: A63 (= A4), H65 (≠ G6), D66 (= D7), I67 (= I8), H68 (≠ A9), W107 (≠ A49), G108 (= G50), G109 (≠ A51), T131 (≠ P73), P132 (≠ F74), Y139 (≠ P81)
Sites not aligning to the query:
6n93A Methylmalonyl-coa decarboxylase in complex with 2-nitronate-propionyl- oxa(dethia)-coa (see paper)
25% identity, 97% coverage: 1:196/203 of query aligns to 60:258/260 of 6n93A
- active site: H65 (≠ G6), L70 (≠ M11), G109 (≠ A51), E112 (≠ G54), P132 (≠ F74), V137 (≠ L79), Y139 (≠ P81), E227 (≠ Q165), Y237 (≠ L175)
- binding [1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethoxy]-1-oxidanylidene-propan-2-ylidene]-bis(oxidanidyl)azanium: A63 (= A4), H65 (≠ G6), D66 (= D7), I67 (= I8), H68 (≠ A9), W107 (≠ A49), T131 (≠ P73), L135 (= L77), F249 (= F187), K252 (= K190)
Sites not aligning to the query:
6n92F Methylmalonyl-coa decarboxylase in complex with 2-nitronate-propionyl- coa (see paper)
25% identity, 97% coverage: 1:196/203 of query aligns to 60:258/260 of 6n92F
- active site: H65 (≠ G6), L70 (≠ M11), G109 (≠ A51), E112 (≠ G54), P132 (≠ F74), V137 (≠ L79), Y139 (≠ P81), E227 (≠ Q165), Y237 (≠ L175)
- binding [1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-1-oxidanylidene-propan-2-ylidene]-bis(oxidanidyl)azanium: A63 (= A4), H65 (≠ G6), D66 (= D7), S105 (≠ I47), W107 (≠ A49), W107 (≠ A49), G108 (= G50), G109 (≠ A51), T127 (≠ R69), F128 (= F70), S129 (≠ L71), T131 (≠ P73), P132 (≠ F74), Y139 (≠ P81), S164 (≠ Q106), P165 (≠ Y107), F249 (= F187)
- binding (2E)-2-(hydroxyimino)propanoic acid: E240 (≠ A178)
Sites not aligning to the query:
6n92A Methylmalonyl-coa decarboxylase in complex with 2-nitronate-propionyl- coa (see paper)
25% identity, 97% coverage: 1:196/203 of query aligns to 60:258/260 of 6n92A
- active site: H65 (≠ G6), L70 (≠ M11), G109 (≠ A51), E112 (≠ G54), P132 (≠ F74), V137 (≠ L79), Y139 (≠ P81), E227 (≠ Q165), Y237 (≠ L175)
- binding [1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-1-oxidanylidene-propan-2-ylidene]-bis(oxidanidyl)azanium: A63 (= A4), H65 (≠ G6), D66 (= D7), I67 (= I8), H68 (≠ A9), W107 (≠ A49), G108 (= G50), G109 (≠ A51), T131 (≠ P73), P132 (≠ F74), Y139 (≠ P81), F249 (= F187), K252 (= K190)
Sites not aligning to the query:
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
28% identity, 96% coverage: 2:195/203 of query aligns to 62:255/258 of 1ey3A
- active site: A66 (≠ G6), M71 (= M11), S81 (≠ A19), L85 (≠ M23), G109 (≠ A51), E112 (≠ G54), P131 (= P73), E132 (≠ F74), T137 (≠ L79), P139 (= P81), G140 (≠ D82), K225 (≠ Q165), F235 (≠ L175)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: A64 (= A4), G65 (= G5), A66 (≠ G6), D67 (= D7), I68 (= I8), L85 (≠ M23), W88 (≠ I26), G109 (≠ A51), P131 (= P73), L135 (= L77), G140 (≠ D82)
Sites not aligning to the query:
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
28% identity, 96% coverage: 2:195/203 of query aligns to 64:257/260 of 1dubA
- active site: A68 (≠ G6), M73 (= M11), S83 (≠ A19), L87 (≠ M23), G111 (≠ A51), E114 (≠ G54), P133 (= P73), E134 (≠ F74), T139 (≠ L79), P141 (= P81), G142 (≠ D82), K227 (≠ Q165), F237 (≠ L175)
- binding acetoacetyl-coenzyme a: A66 (= A4), A68 (≠ G6), D69 (= D7), I70 (= I8), Y107 (≠ I47), G110 (= G50), G111 (≠ A51), E114 (≠ G54), P133 (= P73), E134 (≠ F74), L137 (= L77), G142 (≠ D82), F233 (≠ Q171), F249 (= F187)
Sites not aligning to the query:
1ef9A The crystal structure of methylmalonyl coa decarboxylase complexed with 2s-carboxypropyl coa (see paper)
25% identity, 97% coverage: 1:196/203 of query aligns to 61:259/261 of 1ef9A
- active site: H66 (≠ G6), L71 (≠ M11), D82 (vs. gap), R86 (≠ H27), G110 (≠ A51), E113 (≠ G54), P133 (≠ F74), V138 (≠ L79), Y140 (≠ P81), N141 (≠ D82), E228 (≠ Q165), Y238 (≠ L175)
- binding 2-carboxypropyl-coenzyme a: A64 (= A4), H66 (≠ G6), D67 (= D7), I68 (= I8), H69 (≠ A9), W108 (≠ A49), G110 (≠ A51), T132 (≠ P73), P133 (≠ F74), K253 (= K190)
P52045 Methylmalonyl-CoA decarboxylase; MMCD; Transcarboxylase; EC 4.1.1.- from Escherichia coli (strain K12) (see paper)
25% identity, 97% coverage: 1:196/203 of query aligns to 61:259/261 of P52045
- G110 (≠ A51) binding
- T132 (≠ P73) binding
- K253 (= K190) binding
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
28% identity, 96% coverage: 2:195/203 of query aligns to 94:287/290 of P14604
- E144 (≠ G54) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (≠ F74) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
Query Sequence
>Pf6N2E2_1835 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1835
MFSAGGDIATMADLDESGARERMQHIHQLCRLLGQFPMPVISAVEGICAGAGVGLALLGD
VVLSGTKTRFLFPFLKLGLSPDWGLLRTLPARVGVAEAKRMLTHGQYISAEEAVVAGLAD
ECVGLNVMDSAVSLASRMSRLPRDAFSRMKNRLDHPSASLAEELQREEDDQAVLLLGADF
REGFAAFAEKREPQFTSTVDYLV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory