SitesBLAST
Comparing Pf6N2E2_1850 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1850 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
50% identity, 98% coverage: 2:705/715 of query aligns to 13:728/729 of 8pf8A
- binding [2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boronic acid: G76 (= G63), F169 (≠ L156), N173 (≠ R160), S177 (≠ P163), I193 (≠ L179), F313 (= F296)
- binding bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]-bis(oxidanyl)boranuide: M39 (= M27), N40 (= N28), E41 (≠ Q29), T81 (≠ E68), D92 (= D79), V93 (≠ F80)
- binding [(2~{R})-2,3-bis(oxidanyl)propoxy]-[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]borinic acid: M39 (= M27), G77 (= G64), D78 (= D65), M82 (≠ L69), V93 (≠ F80)
- binding (2~{R})-3-bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boranyloxypropane-1,2-diol: T152 (≠ S139), R184 (= R170), A311 (≠ T294), F312 (≠ M295), I673 (≠ V656)
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92
50% identity, 98% coverage: 2:705/715 of query aligns to 14:729/730 of 8oquA
- binding 4-chloranylbenzenesulfonic acid: M40 (= M27), N41 (= N28), E42 (≠ Q29), G77 (= G63), G78 (= G64), D79 (= D65), V80 (≠ L66), D90 (= D76), V94 (≠ F80), L124 (= L110), G125 (= G111), P150 (= P136), E151 (= E137)
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91
50% identity, 98% coverage: 2:705/715 of query aligns to 13:728/729 of 8oqtA
- binding 4-bromanylbenzenesulfonic acid: E41 (≠ Q29), G76 (= G63), G77 (= G64), D78 (= D65), V79 (≠ L66), M82 (≠ L69), D89 (= D76), V93 (≠ F80), T96 (≠ K83), T96 (≠ K83), P149 (= P136), E150 (= E137)
Sites not aligning to the query:
8oqnA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-53
50% identity, 98% coverage: 2:705/715 of query aligns to 13:728/729 of 8oqnA
- binding 1-benzyl-1H-pyrazole-4-carboxylic acid: M39 (= M27), M82 (≠ L69), E150 (= E137), Q172 (≠ E159), F175 (vs. gap), V176 (≠ L162), Q181 (≠ E167), T241 (= T225), F254 (≠ A238), N257 (≠ M241), Q261 (≠ N245), L262 (≠ T246), P266 (vs. gap), P268 (= P251), Q282 (≠ L265), V283 (≠ L266), G302 (≠ S285), Q303 (≠ V286), V304 (≠ Q287), S521 (= S504), G525 (= G508)
8opvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with resveratrol (fragment-b-h11)
50% identity, 98% coverage: 2:705/715 of query aligns to 13:728/729 of 8opvA
- binding resveratrol: M39 (= M27), A75 (= A62), G76 (= G63), M82 (≠ L69), E128 (= E115), P149 (= P136), E150 (= E137), T152 (≠ S139), L153 (= L140), R184 (= R170), F296 (≠ L279)
8opuA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
50% identity, 98% coverage: 2:705/715 of query aligns to 13:728/729 of 8opuA
8oqoA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
50% identity, 98% coverage: 2:705/715 of query aligns to 12:727/727 of 8oqoA
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
50% identity, 98% coverage: 2:705/715 of query aligns to 12:727/728 of 8oqlA
- binding Hexafluorophosphate anion: V37 (≠ A26), N39 (= N28), G75 (= G63), D77 (= D65), M81 (≠ L69), V92 (≠ F80), T95 (≠ K83), P148 (= P136), E149 (= E137), L152 (= L140), Q180 (≠ E167), Q260 (≠ N245), K362 (≠ L346), D363 (= D347), V364 (= V348), V430 (= V414), D476 (≠ E460), K477 (≠ R461), M478 (= M462), P479 (= P463), K506 (= K490)
- binding formamide: V78 (≠ L66), K79 (≠ N67)
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80
50% identity, 98% coverage: 2:705/715 of query aligns to 13:728/728 of 8oqrA
- binding 4-cyanobenzenesulfonic acid: G76 (= G63), G77 (= G64), T81 (≠ E68), M82 (≠ L69), M82 (≠ L69), A85 (≠ F72), D89 (= D76), T96 (≠ K83), L123 (= L110), G124 (= G111), P149 (= P136), E150 (= E137), S366 (= S349), L367 (= L350), E368 (= E351), A420 (= A403), V421 (= V404), F422 (= F405)
8oqqA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-79
50% identity, 98% coverage: 2:705/715 of query aligns to 7:722/723 of 8oqqA
8oqpA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
50% identity, 98% coverage: 2:705/715 of query aligns to 7:722/723 of 8oqpA
- binding 2-azanyl-5-sulfo-benzoic acid: G28 (= G22), S29 (≠ P23), A63 (= A56), K64 (= K57), K64 (= K57), K65 (≠ S58), P143 (= P136), E144 (= E137), L147 (= L140), F307 (= F296), M473 (= M462), P548 (= P537), S599 (≠ P588), L602 (≠ H591), K603 (≠ Y592), S661 (= S650), T662 (≠ V651), G674 (= G663), A698 (≠ E681), R705 (= R688)
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
50% identity, 98% coverage: 2:705/715 of query aligns to 15:730/731 of 4b3iA
- active site: G79 (= G64), E100 (= E85), R104 (≠ N89), G127 (= G112), E130 (= E115), P151 (= P136), E152 (= E137), G160 (= G145), S452 (= S433), H473 (= H454), E485 (= E466), S523 (= S504)
- binding adenosine-5'-diphosphate: Q640 (≠ V621), P641 (≠ L622), P642 (= P623), L643 (≠ V624), Q644 (≠ E625)
- binding coenzyme a: T38 (≠ V24), V40 (≠ A26), A77 (= A62), G79 (= G64), D80 (= D65), V81 (≠ L66), E152 (= E137), F315 (= F296), Q319 (≠ N300)
8oqvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-109
50% identity, 98% coverage: 2:705/715 of query aligns to 11:726/726 of 8oqvA
- binding 4-nitrobenzenesulfonic acid: E39 (≠ Q29), G74 (= G63), M80 (≠ L69), V91 (≠ F80), T94 (≠ K83), T94 (≠ K83), E148 (= E137), L151 (= L140), R182 (= R170), S448 (= S433), S519 (= S504), R520 (= R505), L562 (≠ V547), L566 (= L551), I570 (≠ V555)
Sites not aligning to the query:
8oqsB Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
50% identity, 98% coverage: 2:705/715 of query aligns to 19:734/735 of 8oqsB
- binding 4-phenylbenzenesulfonic acid: M45 (= M27), I50 (≠ R32), G82 (= G63), G83 (= G64), D84 (= D65), T87 (≠ E68), T87 (≠ E68), M88 (≠ L69), M88 (≠ L69), A91 (≠ F72), D95 (= D76), D98 (= D79), V99 (≠ F80), T102 (≠ K83), T102 (≠ K83), E134 (= E115), E156 (= E137), L159 (= L140), F302 (≠ L279), F302 (≠ L279), F319 (= F296), S456 (= S433), T457 (= T434), M485 (= M462), P486 (= P463), G523 (= G500), S527 (= S504), N535 (≠ D512), P560 (= P537), M575 (= M552), I578 (≠ V555), I578 (≠ V555), I682 (= I659), M683 (≠ L660), G686 (= G663)
Sites not aligning to the query:
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
50% identity, 98% coverage: 2:705/715 of query aligns to 2:710/711 of 7o4uA
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
34% identity, 99% coverage: 2:708/715 of query aligns to 39:754/763 of P40939
- V282 (≠ I235) to D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- I305 (≠ L257) to N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
- L342 (≠ T294) to P: in LCHAD deficiency; dbSNP:rs137852772
- E510 (= E466) active site, For hydroxyacyl-coenzyme A dehydrogenase activity; to Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
34% identity, 100% coverage: 2:714/715 of query aligns to 2:702/707 of 6yswA
- active site: A66 (≠ G64), I71 (≠ L69), A84 (= A82), Q88 (≠ K88), G112 (= G112), E115 (= E115), P136 (= P136), E137 (= E137), G145 (= G145), D264 (= D269), S422 (= S433), H443 (= H454), E455 (= E466), N493 (≠ S504)
- binding coenzyme a: E23 (vs. gap), M25 (≠ V24), A66 (≠ G64), D67 (= D65), I68 (≠ L66), P136 (= P136), E137 (= E137), L140 (= L140), T290 (≠ N300), K293 (vs. gap)
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
34% identity, 98% coverage: 12:714/715 of query aligns to 16:705/707 of 1wdmA
- active site: A69 (≠ G64), N89 (≠ K83), N93 (≠ T87), G117 (= G112), E120 (= E115), P139 (= P136), E140 (= E137), P147 (= P144), G148 (= G145), S430 (= S433), H451 (= H454), E463 (= E466), N501 (≠ S504)
- binding acetyl coenzyme *a: K142 (≠ S139), D297 (≠ M299), M459 (= M462), N501 (≠ S504), P534 (= P537), Y652 (≠ L660), L658 (≠ T666)
- binding nicotinamide-adenine-dinucleotide: G321 (= G324), A322 (= A325), I324 (≠ M327), M325 (= M328), D344 (= D347), V401 (= V404), E403 (= E406), N428 (= N431), S430 (= S433), N454 (≠ S457)
P21177 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 98% coverage: 11:712/715 of query aligns to 15:711/729 of P21177
- G116 (= G112) mutation to F: Absence of both enoyl-CoA hydratase and 3-hydroxyacyl-CoA epimerase activities. Delta(3)-cis-Delta(2)-trans-enoyl-CoA isomerase is only slightly affected.
- G322 (= G326) mutation to A: 10-fold increase in KM for NADH.
- H450 (= H454) active site, For 3-hydroxyacyl-CoA dehydrogenase activity; mutation H->A,Q: Almost complete loss of 3-hydroxyacyl-CoA dehydrogenase activity.
6tnmA E. Coli aerobic trifunctional enzyme subunit-alpha (see paper)
33% identity, 98% coverage: 11:712/715 of query aligns to 15:711/719 of 6tnmA
- active site: A68 (≠ G64), F73 (≠ L69), G116 (= G112), E119 (= E115), P138 (= P136), E139 (= E137), G147 (= G145), N271 (≠ L273), S429 (= S433), H450 (= H454), E462 (= E466), N500 (≠ S504)
- binding adenosine-5'-triphosphate: D343 (= D347), I344 (≠ V348), V400 (= V404), V401 (≠ F405), V406 (≠ L410), K584 (≠ H591)
Query Sequence
>Pf6N2E2_1850 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1850
MSAFNYEKDADGIVTVTMDMPGPVNAMNQLYRETMAATVNRLEQENGLTGVVIASAKSTF
FAGGDLNELTDFKPGDEADFQAKIELTKNDLRRLERLPVPVVAAINGAALGGGFEIALAC
NYRVLLNSPAAVVGLPEVSLGLLPGGGGIVRLVHHLGLERALPLLLEGKRMKPAEALALG
LVNELIEQADALVPAAKAWIKAQVGDDGVSLQPWDHKGHKIPGGTAQQPHVAQMIAGAQA
MTAKNTRGLLPAPERILAVAVEATLLDFDAALLVETRGLTHLAASVQAKNIINTMFFQMN
EVNGGSSRPTGFDKSKVSKLGIIGAGMMGNGIAHVSAKVGIEVMLLDVSLEAAERGKANV
EKLLSKTVSQGRLSEAKKDEILALIKPTVDYADLQGVDFVVEAVFESVDLKGKVTQQAEA
QLPESAVFGTNTSTLPISLLANASKRPANFIGIHFFSPVERMPLVEIICGEQTSDAALAK
AFDFARQIGKTAIVVNDSLGFFTSRTFGSYFDEGCKLLQEGVDPLLIDNLGKQIGMPVGP
LTVLDEVSLELMRKVNETQKEMGVFATVFDNSHSDAVGNILIKEYNRPGRHYGGGFYDYP
EGGEKTIWPGLYELFVRPEVVLPVEDIKERLLFRQVIEAVKCLQEGVLRSVADGNVGSIL
GIGAPTWTGGFLQFVNGYGVERFVQRARELAQTYGERFTPPVLLLEKAAKGEELR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory