Comparing Pf6N2E2_1851 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1851 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7o4tD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme with coenzyme a bound at the hydratase, thiolase active sites and possible additional binding site (coa(ech/had)) (see paper)
58% identity, 100% coverage: 1:402/402 of query aligns to 1:403/403 of 7o4tD
O53871 Putative acyltransferase Rv0859; EC 2.3.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
58% identity, 100% coverage: 1:402/402 of query aligns to 1:403/403 of O53871
8opyD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-b-dnq
59% identity, 100% coverage: 1:402/402 of query aligns to 1:401/401 of 8opyD
8opuC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
59% identity, 100% coverage: 2:402/402 of query aligns to 1:399/399 of 8opuC
8oqmD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-10
59% identity, 100% coverage: 1:402/402 of query aligns to 1:399/399 of 8oqmD
8pf8C Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
58% identity, 100% coverage: 2:402/402 of query aligns to 1:402/402 of 8pf8C
8oqsC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
58% identity, 100% coverage: 2:402/402 of query aligns to 1:402/402 of 8oqsC
8oqpC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
58% identity, 100% coverage: 2:402/402 of query aligns to 1:402/402 of 8oqpC
4b3iC Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
58% identity, 100% coverage: 2:402/402 of query aligns to 1:402/402 of 4b3iC
8opxC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with trehalose (fragment-b-tre)
59% identity, 100% coverage: 2:402/402 of query aligns to 1:398/398 of 8opxC
8oqlC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
58% identity, 100% coverage: 2:402/402 of query aligns to 1:397/397 of 8oqlC
8oqoC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
58% identity, 100% coverage: 2:402/402 of query aligns to 1:398/398 of 8oqoC
6pccA Crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex hexanoyl coenzyme a (see paper)
41% identity, 99% coverage: 5:402/402 of query aligns to 7:403/403 of 6pccA
6pcbA Crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex with coa (see paper)
41% identity, 99% coverage: 5:402/402 of query aligns to 7:403/403 of 6pcbA
6pcdA Crystal structure of beta-ketoadipyl-coa thiolase mutant (c90s-h356a) in complex octanoyl coenzyme a (see paper)
41% identity, 99% coverage: 5:402/402 of query aligns to 8:401/401 of 6pcdA
Q9BWD1 Acetyl-CoA acetyltransferase, cytosolic; Acetyl-CoA transferase-like protein; Cytosolic acetoacetyl-CoA thiolase; EC 2.3.1.9 from Homo sapiens (Human) (see 2 papers)
36% identity, 100% coverage: 2:401/402 of query aligns to 5:396/397 of Q9BWD1
1wl4A Human cytosolic acetoacetyl-coa thiolase complexed with coa (see paper)
36% identity, 100% coverage: 2:401/402 of query aligns to 2:393/394 of 1wl4A
2vu1A Biosynthetic thiolase from z. Ramigera. Complex of with o-pantheteine- 11-pivalate. (see paper)
36% identity, 99% coverage: 4:402/402 of query aligns to 3:391/391 of 2vu1A
2vu2A Biosynthetic thiolase from z. Ramigera. Complex with s-pantetheine-11- pivalate. (see paper)
36% identity, 99% coverage: 4:402/402 of query aligns to 1:389/389 of 2vu2A
1dm3A Acetylated biosynthetic thiolase from zoogloea ramigera in complex with acetyl-coa (see paper)
36% identity, 99% coverage: 4:402/402 of query aligns to 1:389/389 of 1dm3A
>Pf6N2E2_1851 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1851
MSQAVFIYDAVRTPRGKGKKDGALYSVKPVHMAAGLLTELQQRYDLDTSRVDDVVLGCGQ
PVGEQGGDVAKCVVQYAGWDESVPGVQIDRFCASGLEAVNQAASRIASGWEDLIVAGGVE
SMSRLPMGAAGQAWIQDPEIAFKLQSVPQGIGADLLAALDGYSREDVDRFALVSQQRAAH
ARDSGYFDRSVVPVRDLNGLVVLERDEFIKPATTLEALSQLKPSFAAMGKLGYSDVALRK
YPQVARIEPIHTAGNSSGIVDGASATLLGSERIGQQLGLAPRGRIIATAVLSTEPTLMLA
GPGPAAKKALAKAGLSVQDIDLFEINEAFASVVLRFMRDLDISPEITNVNGGAIALGHPI
GATGAMLVGTVLDELERRNLKRGLIALCVGGGMGIATIIERL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory