SitesBLAST
Comparing Pf6N2E2_1895 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1895 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
7cdyA Crystal structure of glucose dehydrogenase
51% identity, 91% coverage: 31:369/372 of query aligns to 5:343/346 of 7cdyA
7cgzA Glucose dehydrogenase
48% identity, 91% coverage: 31:369/372 of query aligns to 5:318/321 of 7cgzA
P75804 Aldose sugar dehydrogenase YliI; Asd; Soluble aldose sugar dehydrogenase YliI; EC 1.1.5.- from Escherichia coli (strain K12) (see paper)
45% identity, 98% coverage: 9:372/372 of query aligns to 8:370/371 of P75804
- Q82 (= Q83) binding
- E240 (= E242) binding
- Y250 (= Y252) binding
- Y261 (= Y263) binding
2g8sA Crystal structure of the soluble aldose sugar dehydrogenase (asd) from escherichia coli in the apo-form (see paper)
45% identity, 94% coverage: 25:372/372 of query aligns to 1:348/348 of 2g8sA
2ismB Crystal structure of the putative oxidoreductase (glucose dehydrogenase) (ttha0570) from thermus theromophilus hb8
34% identity, 91% coverage: 27:365/372 of query aligns to 2:319/333 of 2ismB
3a9hA Crystal structure of pqq-dependent sugar dehydrogenase holo-form (see paper)
33% identity, 91% coverage: 26:365/372 of query aligns to 3:320/338 of 3a9hA
- active site: H120 (= H149), D139 (≠ E168), R182 (= R217), T224 (= T258), K226 (= K267), G228 (= G269)
- binding calcium ion: E208 (= E242), Y218 (= Y252)
- binding alpha-D-glucopyranose: G228 (= G269), R229 (≠ D270), F232 (≠ T273), V233 (≠ A274), D234 (≠ K275)
- binding pyrroloquinoline quinone: E57 (≠ Q83), H120 (= H149), N183 (= N218), Q185 (= Q220), H201 (= H235), V204 (≠ Q238), T243 (≠ Y284), L269 (= L315), R270 (≠ K316), R298 (= R343), R300 (= R345), R320 (≠ K365)
3a9gA Crystal structure of pqq-dependent sugar dehydrogenase apo-form (see paper)
33% identity, 91% coverage: 26:365/372 of query aligns to 3:320/338 of 3a9gA
- active site: H120 (= H149), D139 (≠ E168), R182 (= R217), T224 (= T258), K226 (= K267), G228 (= G269)
- binding calcium ion: E208 (= E242), Y218 (= Y252)
- binding alpha-D-glucopyranose: R144 (≠ K173), D148 (≠ E178), G228 (= G269), R229 (≠ D270), F232 (≠ T273), V233 (≠ A274), D234 (≠ K275)
1cruA Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqq and methylhydrazine (see paper)
28% identity, 92% coverage: 20:360/372 of query aligns to 10:422/448 of 1cruA
- active site: H142 (= H149), D161 (≠ E168), R226 (= R217), A267 (≠ I257), Y269 (= Y259), D271 (≠ E261), E307 (≠ G277)
- binding calcium ion: G245 (= G236), P246 (= P237), E251 (= E242), Y261 (= Y252), A267 (≠ I257), Y269 (= Y259), D271 (≠ E261), E307 (≠ G277)
- binding methylhydrazine: Y341 (vs. gap), W344 (vs. gap)
- binding pyrroloquinoline quinone: Q76 (= Q83), H142 (= H149), R226 (= R217), N227 (= N218), Q244 (≠ H235), Y341 (vs. gap), T346 (≠ S288), A348 (= A290), L374 (= L315), K375 (= K316), R404 (= R343), R406 (= R345)
3dasA Structure of the pqq-bound form of aldose sugar dehydrogenase (adh) from streptomyces coelicolor
29% identity, 90% coverage: 32:365/372 of query aligns to 14:318/334 of 3dasA
- active site: H127 (= H149), E146 (= E168), R189 (= R217), E230 (= E261), K232 (≠ Y263), G234 (= G265)
- binding alpha-L-arabinopyranose: K199 (≠ D227), D248 (≠ P287), R268 (≠ K316), G269 (≠ F317), E270 (≠ G318), K278 (= K326), G279 (≠ D327)
- binding calcium ion: G208 (= G236), Q209 (≠ P237), E214 (= E242), Y224 (= Y252)
- binding pyrroloquinoline quinone: E66 (≠ Q83), H127 (= H149), R189 (= R217), N190 (= N218), Q192 (= Q220), F207 (≠ H235), S251 (≠ A290), R268 (≠ K316), R296 (= R343), R298 (= R345), R318 (≠ K365)
5minB Apo form of the soluble pqq-dependent glucose dehydrogenase from acinetobacter calcoaceticus
28% identity, 92% coverage: 20:360/372 of query aligns to 10:424/453 of 5minB
- active site: H144 (= H149), D163 (≠ E168), R228 (= R217), A269 (≠ I257), Y271 (= Y259), D273 (≠ E261), E309 (≠ G277)
- binding calcium ion: E253 (= E242), Y263 (= Y252), A269 (≠ I257), Y271 (= Y259), D273 (≠ E261), E309 (≠ G277)
P13650 Quinoprotein glucose dehydrogenase B; Glucose dehydrogenase B [pyrroloquinoline-quinone]; Soluble glucose dehydrogenase; s-GDH; EC 1.1.5.2 from Acinetobacter calcoaceticus (see paper)
28% identity, 92% coverage: 20:360/372 of query aligns to 34:448/478 of P13650
- Q100 (= Q83) binding
- D167 (≠ A148) binding
- Q192 (vs. gap) binding
- R252 (= R217) binding
- G271 (= G236) binding
- P272 (= P237) binding
- E277 (= E242) binding
- Y287 (= Y252) binding
- A293 (≠ I257) binding
- Y295 (= Y259) binding
- D297 (≠ E261) binding
- E333 (≠ G277) binding
- Y367 (vs. gap) binding
- T372 (≠ S288) binding
- K401 (= K316) binding
1cq1A Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqqh2 and glucose (see paper)
28% identity, 92% coverage: 20:360/372 of query aligns to 10:418/444 of 1cq1A
- active site: H138 (= H149), D157 (≠ E168), R222 (= R217), A263 (≠ I257), Y265 (= Y259), D267 (≠ E261), E303 (≠ G277)
- binding beta-D-glucopyranose: D137 (≠ A148), H138 (= H149), Q162 (vs. gap), Y337 (vs. gap)
- binding calcium ion: G241 (= G236), P242 (= P237), E247 (= E242), Y257 (= Y252), A263 (≠ I257), Y265 (= Y259), D267 (≠ E261), E303 (≠ G277)
- binding pyrroloquinoline quinone: Q76 (= Q83), H138 (= H149), R222 (= R217), N223 (= N218), Q240 (≠ H235), Y337 (vs. gap), T342 (≠ S288), A344 (= A290), L370 (= L315), K371 (= K316), R400 (= R343), R402 (= R345)
1c9uA Crystal structure of the soluble quinoprotein glucose dehydrogenase in complex with pqq (see paper)
28% identity, 92% coverage: 20:360/372 of query aligns to 10:418/444 of 1c9uA
- active site: H138 (= H149), D157 (≠ E168), R222 (= R217), A263 (≠ I257), Y265 (= Y259), D267 (≠ E261), E303 (≠ G277)
- binding calcium ion: R222 (= R217), G241 (= G236), P242 (= P237), E247 (= E242), Y257 (= Y252), A263 (≠ I257), Y265 (= Y259), D267 (≠ E261), E303 (≠ G277)
- binding pyrroloquinoline quinone: Q76 (= Q83), H138 (= H149), R222 (= R217), N223 (= N218), Q240 (≠ H235), Y337 (vs. gap), W340 (vs. gap), T342 (≠ S288), L370 (= L315), K371 (= K316), R400 (= R343), R402 (= R345)
Query Sequence
>Pf6N2E2_1895 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1895
MNLKLEWVLVPAFLAMGFAASALAAEVRAERVATGLENPWAVAFLPAHRYLVTERPGRLR
VVGADGSIGPPVEGLPAIAAGGQGGLLDVVTDSAFDVNRMVYFCFSEPAAGGAGNSTAVA
RATLSSNMVRLDNLQVIFSQRPKVSSSAHFGCRIVEAKDGTLFVTLGERYSRKEDAQELD
NHLGKVVRIQKDGVVPTDNPFVGRPGALPEIWSYGHRNSQGATLGPDGRLWMNDHGPQGG
DEINVPLAGRNYGWPVITYGENYGGGKIGDGLTAKDGMEQPLHYWVPSIAPSGMAFLTSD
RYGPAWKGNLFVGSLKFGYLDRIELKDGKVVAEHKLLEDGHARVRDVRQGPDGLLYVLTD
EQDGKLLRLQPR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory