SitesBLAST
Comparing Pf6N2E2_1903 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1903 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
47% identity, 91% coverage: 35:436/444 of query aligns to 34:442/478 of Q47945
- Q37 (≠ P38) modified: Pyrrolidone carboxylic acid
Sites not aligning to the query:
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
47% identity, 89% coverage: 40:436/444 of query aligns to 1:404/433 of 8gy2B
- binding heme c: C18 (= C57), C21 (= C60), H22 (= H61), T46 (= T85), I48 (= I87), Y59 (= Y98), L68 (≠ V107), R73 (≠ A112), V79 (≠ L118), Y80 (= Y119), M83 (= M122), F88 (≠ Y127), R126 (= R165), H165 (= H203), C166 (= C204), C169 (= C207), H170 (= H208), I201 (≠ Y237), A202 (= A238), P203 (= P239), L205 (= L241), W216 (= W252), F224 (≠ Y260), A234 (≠ V270), V235 (= V271), F236 (≠ V272), F236 (≠ V272), M239 (= M275), N301 (≠ K334), C302 (= C335), C305 (= C338), H306 (= H339), M316 (≠ W349), F317 (≠ I350), P318 (= P351), L320 (= L353), P324 (≠ S357), G342 (≠ S375), S352 (≠ D385), V354 (≠ Y387), M356 (= M389), F359 (≠ Y392), M375 (≠ V408)
- binding ubiquinone-10: C21 (= C60), L34 (= L73), P39 (= P78), P81 (= P120), L129 (= L168), W132 (= W171), E168 (≠ S206), R173 (= R211), I197 (≠ L233), D241 (≠ E277)
Sites not aligning to the query:
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
38% identity, 86% coverage: 45:428/444 of query aligns to 1:386/418 of 7w2jC
- binding heme c: C13 (= C57), C16 (= C60), H17 (= H61), T42 (= T85), I44 (= I87), Y55 (= Y98), L75 (= L118), Y76 (= Y119), A78 (= A121), M79 (= M122), R122 (= R165), H161 (= H203), C162 (= C204), C165 (= C207), H166 (= H208), A191 (= A238), P192 (= P239), R223 (≠ V270), P227 (≠ T274), M228 (= M275), V289 (≠ K334), C290 (= C335), C293 (= C338), H294 (= H339), Y305 (≠ W349), Y306 (≠ I350), P307 (= P351), L309 (= L353), N312 (≠ A356), T313 (≠ S357), T314 (≠ S358), D322 (≠ T366), I327 (≠ T371), V331 (≠ S375), R333 (= R377), I340 (vs. gap), M342 (vs. gap), P343 (vs. gap), F345 (vs. gap)
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
38% identity, 86% coverage: 45:428/444 of query aligns to 1:400/413 of 8jejC
- binding heme c: C13 (= C57), C16 (= C60), H17 (= H61), T42 (= T85), I44 (= I87), F60 (= F103), L64 (≠ V107), L75 (= L118), Y76 (= Y119), M79 (= M122), P80 (= P123), Y84 (= Y127), R122 (= R165), C162 (= C204), C165 (= C207), H166 (= H208), I186 (≠ L233), W189 (= W236), A191 (= A238), P192 (= P239), I194 (≠ L241), W205 (= W252), Y213 (= Y260), R223 (≠ V270), M228 (= M275), V303 (≠ K334), C304 (= C335), C307 (= C338), H308 (= H339), Y320 (≠ I350), P321 (= P351), L323 (= L353), T327 (≠ S357), T328 (≠ S358), D336 (≠ T366), I341 (≠ T371), V345 (≠ S375), R347 (= R377), I354 (vs. gap), M356 (vs. gap), F359 (vs. gap), I376 (≠ V404)
- binding ubiquinone-10: M36 (= M79), P77 (= P120), S124 (≠ P167), W128 (= W171), C165 (= C207), L173 (= L220)
Sites not aligning to the query:
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
36% identity, 85% coverage: 35:411/444 of query aligns to 33:410/440 of 8gy3A
- binding heme c: Y52 (≠ D56), C53 (= C57), C56 (= C60), H57 (= H61), S84 (≠ T85), I86 (= I87), W97 (≠ Y98), F102 (= F103), L117 (= L118), F121 (≠ M122), F126 (≠ Y127), R163 (= R165), C203 (= C204), C206 (= C207), H207 (= H208), A232 (= A238), P233 (= P239), L235 (= L241), W245 (= W252), Y253 (= Y260), L254 (= L261), G263 (≠ S269), S264 (≠ V270), M269 (= M275), Y292 (≠ L298), C337 (= C335), C340 (= C338), H341 (= H339), P353 (= P351), L355 (= L353), N358 (≠ A356), N359 (≠ S357), V372 (≠ A370), I377 (≠ V378), G382 (≠ I383), Q383 (≠ P384), I386 (≠ Y387), M388 (= M389), F391 (≠ Y392)
- binding ubiquinone-10: E55 (≠ A59), T76 (= T77), F78 (≠ M79), Y118 (= Y119), P119 (= P120), I160 (≠ L162), G166 (vs. gap), Q167 (≠ L168), F169 (≠ L170), W170 (= W171), H202 (= H203), R210 (= R211), L213 (≠ T214)
6fjaA Crystal structure of t2d three-domain heme-cu nitrite reductase from ralstonia pickettii
38% identity, 23% coverage: 327:430/444 of query aligns to 352:454/455 of 6fjaA
- binding protoporphyrin ix containing fe: T359 (≠ K334), C360 (= C335), C363 (= C338), H364 (= H339), P376 (= P351), P377 (= P352), L378 (= L353), F383 (≠ S359), N400 (≠ S375), G401 (≠ E376), Y410 (≠ D385), S412 (≠ Y387), M414 (= M389), M417 (≠ R393)
Sites not aligning to the query:
- active site: 90, 93, 95, 130, 131, 139, 144, 236, 258, 259, 285
- binding copper (ii) ion: 90, 131, 139, 144
5oboA Crystal structure of nitrite bound d97n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii
38% identity, 23% coverage: 327:430/444 of query aligns to 353:455/456 of 5oboA
- binding heme c: T360 (≠ K334), C361 (= C335), C364 (= C338), H365 (= H339), P377 (= P351), P378 (= P352), L379 (= L353), S382 (= S357), F384 (≠ S359), I395 (≠ A370), N401 (≠ S375), G402 (≠ E376), S413 (≠ Y387), M415 (= M389), M418 (≠ R393)
Sites not aligning to the query:
- active site: 91, 94, 96, 131, 132, 140, 145, 237, 259, 260, 286
- binding copper (ii) ion: 91, 96, 131, 132, 140, 145
- binding nitrite ion: 94, 96, 131
4ax3D Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.6 a resolution (see paper)
38% identity, 23% coverage: 327:430/444 of query aligns to 355:457/457 of 4ax3D
- binding heme c: C363 (= C335), C366 (= C338), H367 (= H339), P379 (= P351), P380 (= P352), L381 (= L353), S384 (= S357), F386 (≠ S359), N403 (≠ S375), G404 (≠ E376), S415 (≠ Y387), M417 (= M389), M420 (≠ R393)
Sites not aligning to the query:
- active site: 93, 96, 98, 133, 134, 142, 147, 239, 261, 262, 288
- binding copper (ii) ion: 93, 98, 133, 134, 142, 147
2zooA Crystal structure of nitrite reductase from pseudoalteromonas haloplanktis tac125
34% identity, 22% coverage: 331:428/444 of query aligns to 343:438/438 of 2zooA
- binding protoporphyrin ix containing fe: C347 (= C335), C350 (= C338), H351 (= H339), F362 (≠ I350), P363 (= P351), P364 (= P352), L365 (= L353), S368 (= S357), Y370 (≠ S359), I382 (≠ T371), L386 (vs. gap), S387 (= S375), G388 (≠ E376), I390 (≠ V378), V392 (≠ A380), Y397 (≠ D385), N398 (≠ S386), G399 (≠ Y387), V400 (≠ R388), M401 (= M389)
Sites not aligning to the query:
- active site: 81, 84, 86, 121, 122, 130, 135, 227, 249, 250, 276
- binding copper (ii) ion: 81, 86, 121, 122, 130, 135
8hddB Complex structure of catalytic, small, and a partial electron transfer subunits from burkholderia cepacia fad glucose dehydrogenase
27% identity, 27% coverage: 309:428/444 of query aligns to 1:121/121 of 8hddB
- binding protoporphyrin ix containing fe: C30 (= C335), C33 (= C338), H34 (= H339), Y46 (≠ I350), P47 (= P351), T54 (≠ S358), V66 (≠ A370), I67 (≠ T371), R73 (= R377), I80 (≠ Y387), M82 (= M389), P83 (= P390)
1dt1A Thermus thermophilus cytochrome c552 synthesized by escherichia coli (see paper)
32% identity, 23% coverage: 328:430/444 of query aligns to 2:112/129 of 1dt1A
- binding heme c: C9 (= C335), C12 (= C338), H13 (= H339), P25 (= P351), H30 (vs. gap), Y43 (vs. gap), V47 (≠ A370), Q53 (≠ E376), G54 (≠ R377), G65 (= G382), M67 (≠ P384), F70 (≠ Y387)
Sites not aligning to the query:
1r0qA Characterization of the conversion of the malformed, recombinant cytochrome rc552 to a 2-formyl-4-vinyl (spirographis) heme (see paper)
32% identity, 23% coverage: 328:430/444 of query aligns to 3:113/130 of 1r0qA
- binding 2-formyl-protoporphryn ix: C13 (= C338), H14 (= H339), P26 (= P351), L28 (= L353), H31 (vs. gap), Y44 (vs. gap), V48 (≠ A370), Q54 (≠ E376), G55 (≠ R377), G66 (= G382), M68 (≠ P384)
Sites not aligning to the query:
1qyzA Characterization of the malformed, recombinant cytochrome rc552 (see paper)
32% identity, 23% coverage: 328:430/444 of query aligns to 3:113/130 of 1qyzA
- binding 2-acetyl-protoporphyrin ix: Y7 (≠ M332), C10 (= C335), C13 (= C338), H14 (= H339), P26 (= P351), H31 (vs. gap), Y44 (vs. gap), Q54 (≠ E376), G55 (≠ R377), G66 (= G382), M68 (≠ P384), F71 (≠ Y387)
Sites not aligning to the query:
1c52A Thermus thermophilus cytochrome-c552: a new highly thermostable cytochromE-C structure obtained by mad phasing (see paper)
32% identity, 23% coverage: 328:430/444 of query aligns to 4:114/131 of 1c52A
- binding protoporphyrin ix containing fe: C11 (= C335), C14 (= C338), H15 (= H339), F26 (≠ I350), P27 (= P351), L29 (= L353), H32 (vs. gap), Y45 (vs. gap), L54 (≠ S375), Q55 (≠ E376), G56 (≠ R377), G67 (= G382), M69 (≠ P384), F72 (≠ Y387)
Sites not aligning to the query:
Query Sequence
>Pf6N2E2_1903 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1903
VNKTIKYLLPAGIVVAAGLGWFVNRTPFSPFANEASAPSADAQLVQRGEYVARLSDCVAC
HSTPKGAPFAGGLEMATPMGSIYATNITPDKQTGIGNYSLADFDRAVRSGVAADGHRLYP
AMPYPSYAKLSDDDVRALYAFFMAGVKPAQQQNQQSHIPWPLNMRWPLALWNTAFVDDGA
YQAKPSEDALWNRGAYIVQGAGHCGSCHTPRSLTMNEKSLDESSATFLSGSLLDGWYAPS
LRQDPNTGLGRWSEQEIVDYLKTGRNAHSVVVGTMAEVFNNSTQYMSDPDLKAIAHYLVS
LPGDPKRDGPPWKPAAKLAEQPLSTPGAANYMAKCSSCHGSDGSGQAPWIPPLAGASSSM
VKEGATSINATLNGSERVVANGIPDSYRMPPYRNQLSDQEVADVLTFVRTSWGNQGGAVK
ADEVKELRERTNPASSNPIILQMR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory