Comparing Pf6N2E2_1930 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1930 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 47% coverage: 6:218/456 of query aligns to 35:256/583 of Q9Y7Q9
Sites not aligning to the query:
8fvzA Pipt y150a
26% identity, 90% coverage: 18:427/456 of query aligns to 11:421/433 of 8fvzA
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 45% coverage: 11:214/456 of query aligns to 64:277/587 of P25297
Sites not aligning to the query:
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
23% identity, 95% coverage: 25:456/456 of query aligns to 26:490/491 of P0AGF4
Sites not aligning to the query:
>Pf6N2E2_1930 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1930
MTKTKTTSSRRSLAAGAIGNFGEIYDFAVFGFSIPILSVHFFPGSDRTAALLSTFAVYAV
AFVARPLGGLMFGYLADRLGRIRVMAMTVWLMALGTAIIGLLPTYATIGIAAPLLLLLCR
IAQGLALGGETTGSTSYIVESAPENRRGYWLGFTLIFSHLPNAVVAGLVVALQLGAGDQA
YSDWAWRIPFLLGGIIGVVGFWLRRNIDEPEEYKQARQASKASKIKKNPLIAAIRCGGLR
GMLHVFMVQPVFSVGAYLLLGFMYTFLIEVGKLDSTSALISNAIAVIVLSALLPLGGLLS
DRFGRKRVLTFGAAWIALSAYPAMYLAASGSFASAVAGQTLLAAGLGIYGAASFVAAAEF
FPTSFRATGHAISYQTSVAMFGGTCPLIAAYLSQAFGSPLAPAFYVTLIAVLCLITTQFV
PETRGVNLRTSVGNKTSNKASELPQPQKAMRQELST
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory