Comparing Pf6N2E2_2025 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2025 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6agmA Molecular basis for feedback inhibition of tyrosine-regulated 3-deoxy- d-arabino-heptulosonate-7-phosphate synthase from escherichia coli (see paper)
53% identity, 91% coverage: 29:352/356 of query aligns to 19:326/334 of 6agmA
4hsoA Crystal structure of s213g variant dah7ps from neisseria meningitidis (see paper)
51% identity, 88% coverage: 32:345/356 of query aligns to 21:331/345 of 4hsoA
1kflA Crystal structure of phenylalanine-regulated 3-deoxy-d-arabino- heptulosonate-7-phosphate synthase (dahp synthase) from e.Coli complexed with mn2+, pep, and phe (see paper)
48% identity, 94% coverage: 13:347/356 of query aligns to 1:340/350 of 1kflA
P0AB91 Phospho-2-dehydro-3-deoxyheptonate aldolase, Phe-sensitive; 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase; DAHP synthase; Phospho-2-keto-3-deoxyheptonate aldolase; EC 2.5.1.54 from Escherichia coli (strain K12) (see paper)
48% identity, 94% coverage: 13:347/356 of query aligns to 1:340/350 of P0AB91
5dceA Neisseria meningitidis 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase regulated (tryptophan) (see paper)
51% identity, 88% coverage: 32:345/356 of query aligns to 21:331/344 of 5dceA
5dcdA Neisseria meningitidis 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase regulated (tyrosine)
51% identity, 88% coverage: 32:345/356 of query aligns to 23:333/346 of 5dcdA
5dcbC Neisseria meningitidis 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase regulated and complexed with pep
51% identity, 88% coverage: 32:345/356 of query aligns to 25:335/348 of 5dcbC
4umbA Structural analysis of substrate-mimicking inhibitors in complex with neisseria meningitidis 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase - the importance of accommodating the active site water (see paper)
51% identity, 88% coverage: 32:345/356 of query aligns to 11:321/335 of 4umbA
5cksB Dahp (3-deoxy-d-arabinoheptulosonate-7-phosphate) synthase in complex with dahp oxime. (see paper)
49% identity, 90% coverage: 28:347/356 of query aligns to 15:335/345 of 5cksB
8e0sD Dahp (3-deoxy-d-arabinoheptulosonate-7-phosphate) synthase complexed with dahp oxime in unbound:(bound)2:unbound conformations (see paper)
49% identity, 90% coverage: 28:347/356 of query aligns to 14:334/343 of 8e0sD
7rudB Dahp synthase complex with trifluoropyruvate oxime (see paper)
49% identity, 90% coverage: 28:347/356 of query aligns to 14:334/343 of 7rudB
4umcA Structural analysis of substrate-mimicking inhibitors in complex with neisseria meningitidis 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase - the importance of accommodating the active site water (see paper)
51% identity, 88% coverage: 32:345/356 of query aligns to 11:321/334 of 4umcA
4umaA Structural analysis of substrate-mimicking inhibitors in complex with neisseria meningitidis 3 deoxy d arabino heptulosonate 7 phosphate synthase the importance of accommodating the active site water (see paper)
51% identity, 88% coverage: 32:345/356 of query aligns to 10:320/333 of 4umaA
1qr7A Crystal structure of phenylalanine-regulated 3-deoxy-d-arabino- heptulosonate-7-phosphate synthase from escherichia coli complexed with pb2+ and pep (see paper)
49% identity, 90% coverage: 28:347/356 of query aligns to 13:328/338 of 1qr7A
1gg1A Crystal structure analysis of dahp synthase in complex with mn2+ and 2-phosphoglycolate (see paper)
49% identity, 90% coverage: 28:347/356 of query aligns to 14:330/339 of 1gg1A
7rueA Dahp synthase complexed with trifluoropyruvate semicarbazone (see paper)
49% identity, 90% coverage: 28:347/356 of query aligns to 16:330/339 of 7rueA
5cksA Dahp (3-deoxy-d-arabinoheptulosonate-7-phosphate) synthase in complex with dahp oxime. (see paper)
49% identity, 90% coverage: 28:347/356 of query aligns to 16:329/339 of 5cksA
8e0sA Dahp (3-deoxy-d-arabinoheptulosonate-7-phosphate) synthase complexed with dahp oxime in unbound:(bound)2:unbound conformations (see paper)
48% identity, 90% coverage: 28:347/356 of query aligns to 14:326/336 of 8e0sA
7reuB Crystal structure of aro4p, 3-deoxy-d-arabino-heptulosonate-7- phosphate (dahp) synthase from candida auris, l-tyr complex
46% identity, 89% coverage: 36:353/356 of query aligns to 31:351/358 of 7reuB
Sites not aligning to the query:
1ofoA Crystal structure of the tyrosine regulated 3-deoxy-d-arabino- heptulosonate-7-phosphate synthase from saccharomyces cerevisiae in complex with 2-phosphoglycolate (see paper)
47% identity, 91% coverage: 24:347/356 of query aligns to 10:331/344 of 1ofoA
>Pf6N2E2_2025 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2025
MNSSVSALPLSTLNPANEALTLRLPSSLQLKHQLPLSTALSHQVSVHRQAIRAILNGEDA
RLLVIVGPCSIHDPKSALEYATNLARVAHEVSDSMLLVMRAYVEKPRTTVGWKGLAYDPG
LDGSDDMAAGLTLSRELMREMLQLGLPVATELLQPMAASYFDDLLSWVAIGARTTESQIH
REMASGLGMPVGFKNGTDGGVGIACDAMRSAAHPHRHFGVDSQGHPAIIQTPGNPDTHLV
LRGGHRGPNYDQQSVTQIHHDLTRLKIPARIMVDCSHANSGKDPLRQPQVFNDVLEQRLQ
GNRALIGMMLESHLFEGCQPLGPSMRYGVSVTDGCLGWESTERLLREAHRKLQLPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory