Comparing Pf6N2E2_2046 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2046 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ebuA Crystal structure of a sugar kinase (target efi-502312) from oceanicola granulosus, with bound amp/adp crystal form i
41% identity, 97% coverage: 7:302/305 of query aligns to 16:304/306 of 4ebuA
4eumA Crystal structure of a sugar kinase (target efi-502132) from oceanicola granulosus with bound amp, crystal form ii
41% identity, 90% coverage: 7:282/305 of query aligns to 16:279/294 of 4eumA
Sites not aligning to the query:
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
36% identity, 91% coverage: 5:282/305 of query aligns to 9:268/309 of Q53W83
Sites not aligning to the query:
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
36% identity, 91% coverage: 5:282/305 of query aligns to 9:268/300 of 1v1bA
Sites not aligning to the query:
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
36% identity, 91% coverage: 5:282/305 of query aligns to 9:268/301 of 1v1aA
Sites not aligning to the query:
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
24% identity, 87% coverage: 7:271/305 of query aligns to 3:256/306 of 5eynA
Sites not aligning to the query:
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
24% identity, 87% coverage: 7:271/305 of query aligns to 6:259/319 of Q8ZKR2
Sites not aligning to the query:
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
23% identity, 89% coverage: 2:271/305 of query aligns to 2:260/310 of 5yggA
Sites not aligning to the query:
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
23% identity, 95% coverage: 11:299/305 of query aligns to 6:292/311 of 2varA
Sites not aligning to the query:
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
23% identity, 95% coverage: 11:299/305 of query aligns to 7:293/313 of Q97U29
Sites not aligning to the query:
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
26% identity, 73% coverage: 54:277/305 of query aligns to 55:268/308 of 3iq0B
Sites not aligning to the query:
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
23% identity, 89% coverage: 31:300/305 of query aligns to 39:294/312 of 3in1A
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
24% identity, 87% coverage: 7:271/305 of query aligns to 2:248/299 of 1tz3A
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
30% identity, 88% coverage: 5:271/305 of query aligns to 2:260/322 of 3lkiB
Sites not aligning to the query:
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
24% identity, 87% coverage: 7:271/305 of query aligns to 2:248/297 of 1tz6A
Sites not aligning to the query:
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
22% identity, 87% coverage: 7:272/305 of query aligns to 2:263/308 of 2dcnA
Sites not aligning to the query:
2afbA Crystal structure of 2-dehydro-3- deoxygluconokinase (ec 2.7.1.45) (tm0067) from thermotoga maritima at 2.05 a resolution (see paper)
24% identity, 91% coverage: 7:285/305 of query aligns to 7:299/329 of 2afbA
Sites not aligning to the query:
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
23% identity, 87% coverage: 8:273/305 of query aligns to 8:264/312 of 4wjmA
Sites not aligning to the query:
7fcaD Pfkb(mycobacterium marinum) (see paper)
27% identity, 86% coverage: 10:271/305 of query aligns to 6:237/282 of 7fcaD
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
28% identity, 83% coverage: 31:284/305 of query aligns to 38:271/306 of 4xckA
Sites not aligning to the query:
>Pf6N2E2_2046 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2046
MSNPKPRIALIGECMIELQQRADGSLLQSFGGDTLNTAVYLARALGDRGTVDYVTALGDD
SFSDAMCENWAAENIGLQRVQRLPGRLPGLYCIQTDAAGERRFLYWRNEAAVRDCFTTPA
AGPILAALPDYEVLYFSGVTLAVLGEQGRGKLIETLVEARRRGALVVFDNNFRPRLWASI
EAARVAYRSVLPYVELALLTVEDEQALFGHADSEAVFAAYAQLGTPEVVLKRGAEACLIR
CDGQSYEVPALRVERVVDTTAAGDSFSAAYLASRLLGGSPVEAAEAGHLLASRVIQVPGA
LMPKD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory