Comparing Pf6N2E2_2049 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2049 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
7cd4A Crystal structure of the s103f mutant of bacillus subtilis (natto) yabj protein. (see paper)
39% identity, 85% coverage: 19:127/128 of query aligns to 15:124/124 of 7cd4A
Sites not aligning to the query:
2b33B Crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution
38% identity, 85% coverage: 19:127/128 of query aligns to 15:125/126 of 2b33B
P80601 2-iminobutanoate/2-iminopropanoate deaminase; 14.3 kDa perchloric acid soluble protein; Translation inhibitor L-PSP ribonuclease; UK114 antigen; EC 3.5.99.10; EC 3.1.-.- from Capra hircus (Goat) (see paper)
38% identity, 84% coverage: 19:126/128 of query aligns to 20:129/137 of P80601
Sites not aligning to the query:
Q94JQ4 Reactive Intermediate Deaminase A, chloroplastic; 2-iminobutanoate/2-iminopropanoate deaminase; EC 3.5.99.10 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 83% coverage: 19:124/128 of query aligns to 78:185/187 of Q94JQ4
P52759 2-iminobutanoate/2-iminopropanoate deaminase; Liver perchloric acid-soluble protein; L-PSP; Reactive intermediate imine deaminase A homolog; Translation inhibitor L-PSP ribonuclease; UK114 antigen homolog; rp14.5; EC 3.5.99.10 from Rattus norvegicus (Rat) (see paper)
36% identity, 84% coverage: 20:126/128 of query aligns to 21:129/137 of P52759
Sites not aligning to the query:
5hp8A Crystal structures of rida in complex with pyruvate (see paper)
32% identity, 81% coverage: 21:124/128 of query aligns to 1:106/108 of 5hp8A
Q7CP78 2-iminobutanoate/2-iminopropanoate deaminase; Enamine/imine deaminase; EC 3.5.99.10 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
30% identity, 85% coverage: 19:127/128 of query aligns to 16:128/128 of Q7CP78
2uynA Crystal structure of e. Coli tdcf with bound 2-ketobutyrate (see paper)
31% identity, 84% coverage: 19:126/128 of query aligns to 15:126/127 of 2uynA
2uykC Crystal structure of e. Coli tdcf with bound serine (see paper)
31% identity, 84% coverage: 19:126/128 of query aligns to 15:126/127 of 2uykC
3k0tC Crystal structure of pspto -psp protein in complex with d-beta-glucose from pseudomonas syringae pv. Tomato str. Dc3000 (see paper)
33% identity, 82% coverage: 19:123/128 of query aligns to 15:120/124 of 3k0tC
5v4dA Crystal structure of the protein of unknown function of the conserved rid protein family yyfa from yersinia pestis
30% identity, 83% coverage: 19:124/128 of query aligns to 17:125/127 of 5v4dA
3vczB 1.80 angstrom resolution crystal structure of a putative translation initiation inhibitor from vibrio vulnificus cmcp6
30% identity, 84% coverage: 19:126/128 of query aligns to 15:127/127 of 3vczB
A0A1J1DL12 2-iminobutanoate/2-iminopropanoate deaminase; Allergen Der f 34; Enamine/imine deaminase; Allergen Der f 34.0101; EC 3.5.99.10 from Dermatophagoides farinae (American house dust mite) (see paper)
28% identity, 82% coverage: 19:123/128 of query aligns to 18:124/128 of A0A1J1DL12
Sites not aligning to the query:
P0AFQ5 3-aminoacrylate deaminase RutC; 3-AA deaminase; EC 3.5.-.- from Escherichia coli (strain K12) (see paper)
28% identity, 91% coverage: 12:128/128 of query aligns to 9:128/128 of P0AFQ5
3i3fB Hypothetical protein from giardia lamblia gl50803_14299
29% identity, 74% coverage: 34:128/128 of query aligns to 17:128/128 of 3i3fB
Sites not aligning to the query:
3i3fA Hypothetical protein from giardia lamblia gl50803_14299
29% identity, 74% coverage: 34:128/128 of query aligns to 20:131/131 of 3i3fA
Sites not aligning to the query:
>Pf6N2E2_2049 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2049
MSITRYGTGSSAGGGQPRPFARAVEADGWLHVSGQVPAVNGEIIVGGIVEQTHQTMKNLI
AILQEAGYDLKDVVRCGVWLDDPRDFWSFNKVFSEYFSPEHAPARACVQASMMVDCKVEI
DCVAYKKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory