SitesBLAST
Comparing Pf6N2E2_2095 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2095 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 41% coverage: 17:236/540 of query aligns to 35:260/583 of Q9Y7Q9
Sites not aligning to the query:
- 267 modified: Phosphoserine
- 269 modified: Phosphoserine
- 289 modified: Phosphoserine
- 290 modified: Phosphoserine
- 292 modified: Phosphoserine
- 330 modified: Phosphoserine
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
28% identity, 28% coverage: 75:226/540 of query aligns to 187:325/616 of P36035
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 9 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
- 338 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
O42885 Putative inorganic phosphate transporter C8E4.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 42% coverage: 9:235/540 of query aligns to 33:277/572 of O42885
Sites not aligning to the query:
- 12 modified: Phosphoserine
- 14 modified: Phosphoserine
- 292 modified: Phosphoserine
- 296 modified: Phosphoserine
Q09852 Putative inorganic phosphate transporter C23D3.12 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 31% coverage: 14:183/540 of query aligns to 36:211/559 of Q09852
Sites not aligning to the query:
- 297 modified: Phosphoserine
- 299 modified: Phosphoserine
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
24% identity, 41% coverage: 32:252/540 of query aligns to 52:247/444 of Q8NLB7
- D54 (≠ E34) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (= D37) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (≠ M89) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
Q12300 High glucose sensor RGT2; Low-affinity glucose receptor RGT2; Low-affinity transporter-like sensor RGT2; Restores glucose transport protein 2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
27% identity, 45% coverage: 78:321/540 of query aligns to 158:426/763 of Q12300
- R231 (= R158) mutation to K: In RGT2-1; constitutively signaling glucose receptor.
Sites not aligning to the query:
- 684:690 SIISDST→AIIADAA: In Rgt2(4SA); Abolishes Yck-dependent phosphorylation, interaction with MTH1 and STD1, and glucose signaling, but does not affect protein stability.
8fvzA Pipt y150a
25% identity, 56% coverage: 22:325/540 of query aligns to 4:311/433 of 8fvzA
Sites not aligning to the query:
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
26% identity, 27% coverage: 79:224/540 of query aligns to 204:347/727 of Q9Z2I6
Sites not aligning to the query:
- 1:57 Interaction with SYT1
- 529:566 (Microbial infection) C.botulinum neurotoxin type A-binding
- 559 N→A: Loss of one glycosylation site. No effect on C.botulinum neurotoxin type A (BoNT/A, botA) binding, but reduces the uptake of BoNT/A.
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
26% identity, 27% coverage: 79:224/540 of query aligns to 204:347/727 of Q496J9
Sites not aligning to the query:
- 519:563 (Microbial infection) C.botulinum neurotoxin type A-binding
- 534 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 559 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: No change in interaction with C.botulinum neurotoxin type A heavy chain (botA, BoNT/A HC). Decreased molecular weight probably due to glycosylation loss, decreased interaction with BoNT/A HC.; N→Q: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC. Greater reduction in weight; when associated with Q-565.
- 561 S→A: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC.
- 563 F→A: No longer interacts with BoNT/A HC.
- 565 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Decreased molecular weight probably due to glycosylation loss, no change in binding to BoNT/A heavy chain. Greater reduction in weight; when associated with Q-559.
Q4U2R8 Solute carrier family 22 member 6; Organic anion transporter 1; hOAT1; PAH transporter; hPAHT; Renal organic anion transporter 1; hROAT1 from Homo sapiens (Human) (see 6 papers)
26% identity, 46% coverage: 78:325/540 of query aligns to 147:405/563 of Q4U2R8
- Y230 (≠ V179) mutation to A: Loss of membrane protein expression and little uptake of cidofovir.
Sites not aligning to the query:
- 7 L → P: in dbSNP:rs1415632329
- 30 L→A: Complete loss of PAH transport activity.
- 36 T→A: Complete loss of PAH transport activity.
- 39 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Complete loss of PAH transport activity.
- 50 R → H: lower Vmax; increase in substrate affinity and increase in the affinity for the nucleoside phosphonate analogs cidofovir, adefovir and tenofovir; dbSNP:rs11568626
- 56 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 92 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 97 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 104 P → L: in dbSNP:rs11568627
- 113 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 431 K→A: Decrease in the level of membrane protein expression and 70 % loss of PAH uptake.
- 438 F→A: Decrease in the level of membrane protein expression, 70 % loss of PAH uptake, increased affinity for cidofovir, lower Vmax for PAH, and lower Km and Vmax for cidofovir.
O15245 Solute carrier family 22 member 1; Organic cation transporter 1; hOCT1 from Homo sapiens (Human) (see 10 papers)
27% identity, 26% coverage: 37:174/540 of query aligns to 123:249/554 of O15245
- L160 (≠ I74) to F: no changes in both MPP(+) and TEA uptake; abolishes MPP(+) uptake when associated with S-401; largely localized to the plasma membrane; dbSNP:rs683369
- S189 (≠ A106) to L: no changes in MPP(+) uptake; dbSNP:rs34104736
- G220 (≠ A145) to V: affects transporter activity; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs36103319
- Y240 (≠ I165) mutation to F: Decreased TEA uptake.
Sites not aligning to the query:
- 14 S → F: exclusively found in the African American population; increased MPP(+) uptake when associated with V-408; dbSNP:rs34447885
- 24 I→L: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 28 L→I: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 31 A→S: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 32 F→L: No change in fenoterol uptake. Decreased trospium uptake. Decreased trospium affinity.
- 36 C→Y: Increased fenoterol uptake. Increased fenoterol affinity. No change in trospium uptake. No change in terbutaline uptake. No change in terbutaline affinity.
- 41 F → L: in dbSNP:rs2297373
- 61 R → C: affects transporter activity; reduction of MPP(+) uptake; reduction of serum O-isobutanoyl-(R)-carnitine levels; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs12208357
- 85 L → F: no changes in MPP(+) uptake; when associated with V-408; dbSNP:rs35546288
- 88 C → R: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; dbSNP:rs55918055
- 283 P → L: in dbSNP:rs4646277; P→A: Decreased TEA uptake.
- 287 R → G: in dbSNP:rs4646278
- 341 P → L: affects transporter activity; reduction of TEA uptake; reduction o MPP(+) uptake when associated with V-408; largely localized to the plasma membrane; dbSNP:rs2282143
- 342 R → H: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34205214
- 361 Y→F: Decreased TEA uptake.
- 376 Y→F: Decreased TEA uptake.
- 401 G → S: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; no MPP(+) uptake when associated with L-160; dbSNP:rs34130495
- 408 M → V: does not affect transporter activity; no changes in MPP(+) uptake when associated with F-14; no changes in MPP(+) uptake when associated with F-85; no changes in MPP(+) uptake when associated with L-189; no changes in MPP(+) uptake when associated with H-342; no changes in MPP(+) uptake when associated with M-420 del; no changes in MPP(+) uptake when associated with I-440; no changes in MPP(+) uptake when associated with I-461; no changes in MPP(+) uptake when associated with M-488; reduction of MPP uptake when associated with C-61; no MPP(+) uptake when associated with V-220; reduction of MPP(+) uptake when associated with L-341; no MPP(+) uptake when associated with S-401; no MPP(+) uptake when associated with R-465; dbSNP:rs628031
- 420 natural variant: Missing (reduction of serum O-isobutanoyl-(R)-carnitine levels; no change in MPP(+) uptake; no changes in MPP(+) uptake when associated with V-408; dbSNP:rs72552763)
- 440 M → I: in dbSNP:rs35956182
- 461 V → I: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34295611
- 465 G → R: reduction of the localization to the basolateral membrane; no MPP(+) uptake when associated with V-408; dbSNP:rs34059508; G→A: No changes in MPP(+) uptake.
- 488 R → M: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs35270274
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
21% identity, 60% coverage: 7:329/540 of query aligns to 49:433/587 of P25297
- K298 (≠ C233) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Sites not aligning to the query:
- 6 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
8sc2A Human oct1 bound to diltiazem in inward-open conformation (see paper)
27% identity, 26% coverage: 37:174/540 of query aligns to 105:231/453 of 8sc2A
Sites not aligning to the query:
8sc6A Human oct1 bound to thiamine in inward-open conformation (see paper)
27% identity, 26% coverage: 37:174/540 of query aligns to 105:231/447 of 8sc6A
Sites not aligning to the query:
8sc3A Human oct1 bound to fenoterol in inward-open conformation (see paper)
27% identity, 26% coverage: 37:174/540 of query aligns to 105:231/445 of 8sc3A
Sites not aligning to the query:
Query Sequence
>Pf6N2E2_2095 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2095
MSEHVQSLEATRSVGTSQETQKVIFASSLGTVFEWYDFFLYGALAAVISKQFFAGVNDTT
AFIFALMAFAAGFIVRPFGALVFGRLGDMIGRKYTFLATIILMGVATFCVGLLPNYASIG
IAAPIILVVLRMLQGLALGGEYGGAATYVAEHAPMGKRGFHTSWIQSTATLGLLLSLLVV
LGCRYFTGDQFEVWGWRIPFLLSILLLGISTWIRLSLHESPAFLKMKEEGKSCKAPIRES
FGKWENLKVVLIALFSINAGQAVTFYAAQFYVLFFLTQFLKMDPALANSLLIVSVVIGAP
FFIFFGWLSDKVGRKPVLMIGLLLATALYFPIFKTLAHYANPAIDQASRQAPITVIADPA
TCTFQFDPVGKARFDSPCDKVKTFLVKQGLPYSSVAAPAGSTVQVSVGDVKLEGYDEAAL
RGAVTLAGYPQQADAQQINRPMIVALIVALIIISAMCYGPLAALMVELFPTRIRYTSMSL
PYHIGNGWFGGFLPTVSFALVVYTGDIFYGLWYPVVITGVSLVVGMICLRETRSVDLDKN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory